KEGG   Halopiger xanaduensis: Halxa_2156Help
Entry
Halxa_2156        CDS       T01532                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hxa  Halopiger xanaduensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Halxa_2156
   00500 Starch and sucrose metabolism
    Halxa_2156
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Halxa_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1481129..1482067)
Genome map
AA seq 312 aa AA seqDB search
MTSSEGGEYDCVVDPDGSGDYERIQAAIDDAKSFPRERIAIFLKEGVYEEKVTVHSWNPK
IDLIGESADGTVIAHDDHFERIDRGRNSTFFTYTLKVCGNDFRARNLTVRNDAGPEKGQA
VALHVEADRAVFENCRFVGNQDTVYAAGEGSRQYFDDCYLEGTTDFVFGGATAVFDNCEV
HSKADSYVTAASTPRTEPFGFVFDGCTLTAEPNVSEVYLGRPWRDHAHVTFLRSHMDDHI
LPAGWHDWSRPDVVDDVTYAEYENRGPGSRTDDRVPWSETLSPAEAERYAAENVLLRRDS
PKSDWYWHRAIC
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgagcgagggcggtgagtacgactgcgtcgtcgatccggacgggagcggcgac
tacgagcgcatccaggcggcgatcgacgacgcgaagtcgtttcctcgagagcggatcgcg
atcttcctgaaagagggcgtgtacgaggagaaggtcacggtccactcgtggaacccgaag
atcgacctgatcggcgagagcgcggacggaaccgtcatcgcgcacgacgatcacttcgag
cggatcgatcgcgggcgcaacagcacgttcttcacgtacacgctgaaggtgtgcgggaac
gatttccgcgcccgaaacctgaccgtgcggaacgacgccggcccggagaaggggcaggcc
gtcgcgctgcacgtcgaggccgaccgcgccgtcttcgagaactgtcggttcgtcgggaac
caggacacggtctacgccgccggcgagggctcgcggcagtatttcgacgactgctacctc
gaggggacgaccgacttcgtgttcggcggcgctacggccgtgttcgacaactgcgaggtc
cactcgaaagccgattcgtacgtgacggcggcctcgacgccgcgcaccgaaccgttcgga
ttcgtcttcgacggctgtacgctgaccgccgaaccgaacgtctccgaggtgtacctgggc
cgaccctggcgagaccacgcccacgtcacgtttctccggtcacatatggacgatcacatt
cttccggccggctggcacgactggtcccgtccggacgtggtggacgacgtcacgtacgcg
gagtacgagaatcgaggccccggctcgagaacggacgaccgggtgccttggtccgagacg
ctgtcaccggcggaggccgaacggtacgccgccgaaaacgtccttctgcgcagagactcg
ccgaaatccgattggtactggcatcgggcaatttgctga

DBGET integrated database retrieval system