KEGG   Halopiger xanaduensis: Halxa_2185Help
Entry
Halxa_2185        CDS       T01532                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halxa_2185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halxa_2185
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halxa_2185
Enzymes [BR:hxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halxa_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1512607..1513815
Genome map
AA seq 402 aa AA seqDB search
MDRQVRCYDCGKTYRLEERQRCSCGEPLWFDADAETFEWPDDDRNWTAGMWRYEDALPVA
PSSAVPTGSVPGTTPLVRAEGLDEYAGCRLSLKPEGQNPTGSFKDRGTAVGVEYGLRDGH
DWIGTVSHGNMALSTSAYAAAAGLEAAVFVPADTPLERLELIARHGARIFRVEGDYGRLY
AETLGLEAEVGRFVNSDTPLRVAGQKTVAYEILEQFQPSAPDAIVLPVSSGGQASGVWKA
LRELEAAGLLDADDVPRLYLVQAAACDPIATASREGRESVSAIEPGETIAVSIANADPPS
GTRALTAARETGGAVVSVPDEATREAMDRLATAAGISVEPSSAVALAGVRELSRRGELDA
DEEVVTILTGSGYKERYDVDVESRTRTIDLEAVERELAAALE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccaagtccgctgttacgactgcgggaagacgtaccgcctcgaggagcgccag
cgctgttcgtgcggcgaaccgctctggttcgacgccgacgcggagaccttcgagtggccg
gacgacgaccggaactggaccgcgggaatgtggcgctacgaggacgcgctcccggtcgcc
ccctcgtccgcggtgccgacggggtcggtccccggcacgacgccgctcgttcgcgccgag
ggactggacgagtacgccggctgtcgtctctccctgaagccggagggacagaacccgacg
gggagcttcaaggaccgcgggaccgccgtgggcgtcgagtacggcctccgagacggccac
gactggatcggcaccgtctcccacggcaacatggcgctgagcacgagcgcctacgccgcc
gctgccggactcgaggcggcggtcttcgtgccggcggacaccccgctggaacgcctcgag
ttgatcgcccgccacggcgcgcgaatcttccgcgtcgagggcgactacggccggctgtac
gccgagacgctcgggctcgaggccgaggtcgggcgattcgtcaactcggatacgccgctg
cgggtcgccggccagaagacggtcgcgtacgagattctcgagcagtttcagccgagtgcg
ccggacgcgatcgtcctcccggtcagcagcggcggacaggcgagcggggtctggaaggcg
ctccgagaactcgaggcggccggcctgctcgacgccgacgacgtcccgcggctctacctc
gttcaggcggccgcgtgcgatcccatcgcgacggcctcccgcgagggtcgagaatccgtc
tcggcgatcgaaccgggagagacgatcgcggtttcgatcgcgaacgccgatccgcccagc
ggcacccgcgcgctgaccgccgcccgcgagaccggcggtgcggtcgtctccgtccccgac
gaggcgacccgcgaggcgatggatcggctggcgacggcggcggggatctcggtcgaaccc
tcgagcgccgtcgcgctggccggcgtccgcgaactctcccggcggggcgaactcgacgcg
gacgaggaggtcgtgacgatcctcaccggatccgggtacaaggagcgatacgacgtcgac
gtcgagtcccgaacgcggacgatcgacctcgaggcggtcgagcgggaactcgccgccgct
ctcgagtga

DBGET integrated database retrieval system