KEGG   Halopiger xanaduensis: Halxa_2272Help
Entry
Halxa_2272        CDS       T01532                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hxa  Halopiger xanaduensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Halxa_2272
Enzymes [BR:hxa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Halxa_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1591184..1591843
Genome map
AA seq 219 aa AA seqDB search
MILETERRAVVEHASELADLTPGRTGNLSVRGSGDDTDAGPGDAFAITPTGVPYDGFDVE
DVPVVGTDGERLDGEMAPSSEVPMHSAIYRREDVGAIVHTHSPWATALAVANQPLPPIHY
MIVAVGKRVPVAEYAPYGTDELAENIVTAMTEAGSTASLIENHGLVVTAPDLETALENTH
HVESLARLYLESRSAGLEPQTLTDDQLETVLEKFESYGQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcgagaccgagcgccgagcagtcgtcgagcacgcgtccgagttggccgacctc
acgccgggtcggacggggaacctgagcgttcgcggtagcggtgacgacaccgacgccggc
cccggagacgccttcgcgattaccccgaccggcgtcccctacgacgggttcgacgtcgag
gacgtgccggtcgtcggcaccgacggcgagcgactggacggcgagatggcacccagcagc
gaggtgccgatgcacagcgccatctaccggcgcgaggacgtcggcgcgatcgtccacacc
cactcgccgtgggcgacggcgctcgccgtcgcaaaccagccgctgccgccgatccactac
atgatcgtcgccgtcggcaagcgggtccccgtcgccgagtacgctccttacggcaccgac
gaacttgccgaaaacatcgtcactgcgatgaccgaagccggctcgacggcgtcgctcatc
gaaaaccacggcctcgtcgtcaccgctcccgacctagagaccgccctcgagaacacccat
cacgtcgagagcttagcgcggctctacctcgagtcccgttcggcggggctggaaccgcag
acgctgacggacgaccaactcgagacggtgctcgagaagttcgaatcgtatgggcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system