KEGG   Halopiger xanaduensis: Halxa_2346Help
Entry
Halxa_2346        CDS       T01532                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hxa  Halopiger xanaduensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halxa_2346
Enzymes [BR:hxa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Halxa_2346
Peptidases [BR:hxa01002]
 Cysteine Peptidases
  Family C44
   Halxa_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1666718..1668616
Genome map
AA seq 632 aa AA seqDB search
MVGICGVLGDRQHDIESLAETIEWDDDDEETATYRDDTVQVQLSVHRETDAAQPATAQME
SGEQLCWVWGDVIGAEDSTGYTPRQDQSTCDAAYCAGLLEEQGLSFVDGLNSEFAGLVVD
RDRGEATLFTDRLGARPIYLTEALDGRVLFSTHLNTILAHPEFRPTVDDELMSEFFKFER
AFGIYTPFEDVHQLHPGSKLIVDLESGKTSLERYWQPHYRPTEKPYDAFVEEFSSIIQRC
IEERRNPADDDGIFISGGSDSRLLLSLFEDRDVTGYHLNDAMNDEAKTAYKVCEMLDVEF
RFLQRDPEYLTDVLERVGDFQIFSSFFDQAHFAGFEDELTDEIDAVFAGHTADTVLEGFY
MPTRDVDVPGLEWTIPVPILDQIAGVDEYAEHITCDYQYHRGPSVNSQPKCVTLEKDPVA
VLREHMSESGGAIDHHGVRYPSLESLVHTGGFYPITNNKAYLMYYSANQMLPTHYPYLDN
RVIEFSLSVPHRHHVRRSVVNRAVAKRNRALAEIPKAGIGLPLTYPRTVYSAARLWRSFK
SKLGSESGAGGGSWSDPERVVRETDIVEEHLLTPENAERCPDIVDWETLENLYRAHLEGD
NESFELFGALSLCHSYPVANDLLRGKETITDD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggatctgcggcgttctgggcgaccggcagcacgacatcgagtcgctcgccgag
acgatcgaatgggacgacgacgacgaggaaacggcgacctaccgagacgatactgtgcag
gttcaactctccgttcaccgggaaaccgacgcagcgcaacctgcaacagcccaaatggaa
agtggcgagcagttgtgctgggtctggggcgacgttatcggcgccgaagattcgacggga
tatacgccaaggcaggatcagtcaacgtgcgatgcggcgtactgcgcaggcttactcgag
gagcaggggctgtcgttcgtcgacggactgaacagcgagtttgcgggactggtagtggat
cgagaccgcggcgaggcgacgctgtttaccgaccgactcggcgcccgaccgatttacctc
acggaagcgctcgacggccgcgtcctgttttcgacccacctgaacacgatcttggcgcac
ccggagtttcgaccgaccgtcgatgacgagctcatgtcggagtttttcaagttcgagcgg
gccttcgggatctacacgccgttcgaggatgtccaccaactacatcctggatcgaaactc
atcgtcgatctcgagagcggaaaaacatcgctcgagcgctactggcaacctcactatcgg
ccgacggaaaaaccgtacgatgcgttcgtcgaggagttttcctcgatcatacagcggtgc
atcgaggagcgccggaatccggcggacgacgatggcatcttcattagcggcggcagcgac
tcgcggctgctcctgtcgctgttcgaggaccgcgacgtgacgggataccacctgaacgac
gcgatgaacgacgaggcgaagacggcttacaaagtctgtgagatgctggacgtcgagttc
cgatttctccagcgcgatccggagtacctgacggacgtgctggagcgagtgggcgacttt
cagattttctcctcgttcttcgatcaggcgcacttcgcagggtttgaggatgaactcacc
gacgaaatcgacgccgtcttcgccggtcacacagccgatactgtcctcgaggggttttac
atgccgacgcgggatgtcgacgtccccggactcgagtggacgattccagtcccgatcctc
gatcagatcgcgggtgtcgacgagtacgccgagcacatcacctgtgactatcagtatcac
cgcggtccgtcggtaaactcacagccgaagtgcgtgactctcgagaaggaccccgtcgcg
gtgctgcgagagcacatgtcggaatcgggcggcgctatcgaccaccacggcgtgcgctat
ccgtcgctcgaatcgctcgtccacaccggcggcttctacccgatcacgaacaacaaggcg
taccttatgtactactccgcgaaccagatgcttccgacgcactacccatacctcgataat
cgagtgatcgagttctcgttgtccgttccgcaccgccaccacgtccgccggagcgtcgtc
aaccgggccgtggcgaagcggaaccgcgccctggctgagattccaaaggcggggatcggt
ctgccgttgacctacccgagaacggtgtacagcgccgcgcggctgtggcggagcttcaaa
agcaagctcggatcggagtcgggagccggcggcggatcctggagcgatcccgagcgcgtc
gtccgggagaccgacatcgtcgaggagcacctgctgacccccgagaacgccgagcggtgt
ccggatatcgtcgattgggaaacgctcgagaacctgtaccgagcccatctcgagggagat
aacgagtccttcgagttgttcggcgcgctttcgctctgtcactcgtatccggtcgcaaac
gatctgctacggggcaaggaaacgataaccgacgactga

DBGET integrated database retrieval system