KEGG   Halopiger xanaduensis: Halxa_2428Help
Entry
Halxa_2428        CDS       T01532                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hxa  Halopiger xanaduensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1752421..1754091
Genome map
AA seq 556 aa AA seqDB search
MSTETPDSDDPTETEAFRQVCETLVDRILAGEIERDEVEKAKLEACSEHSAPKVPKNSEL
LDYAPQEHREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQS
YTGEEPAAARGVQNDYDPYGQVTLRLEQLREIGHPVDKVELILMGGTMTARSHDYQEWFV
KRALEAMNDYDVDKEPEPAEGESFAQDPEEYEFRYLEDVIAENETADVRNIGTTFETKPD
WCDPEQIDRMLDLGGTKVEVGVQTTYERVNREMHRGHGVQESMDANQRLRDSAFKVGFHM
MPGQPGMSKEMCLEDFRRIFEEEEWKPDYLKIYPMLIVRDTATYDWWHRGEFEPLGNDEA
AELIAEIKDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARQRMEEHGWSCDCIRCRE
VGMNDEEPENVELDVMTYDACGGTEHFISVEDFDKDLLIGFCRLRFPSNPVRPELENAAL
IRELHVYGSEVTMGDEGETDQHQHRGYGRRLMEKAEELAADAGYDKVSVISGIGAREYYR
NKLGYHQDGPYVSKRL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgattccgacgatcccacggaaaccgaagccttccggcaggtc
tgcgagacgctagtcgaccggatcctcgcgggcgagatcgagcgcgacgaggtcgagaag
gccaaactcgaggcctgctcggagcactcggccccgaaggtgccgaaaaactccgagctg
ctcgactacgcgccccaggagcaccgcgaggacctcgaggcggtgctccagcgcaagccg
gtccgcaccgcatcgggagtctcgccggtcgcgatcatgacctcgcccgagcgctgcccg
cacgggaagtgtctctactgtcccggcggccctgactcggagttttcctcctcgcagagc
tacacgggcgaagaacccgctgcggcccgcggcgtccagaacgattacgatccgtacggg
caggtgacgctgcgcctcgagcagttgcgcgagatcggccaccccgtcgacaaagtggag
ctgatcctgatgggcggcaccatgaccgcccgctcccacgactaccaggagtggttcgtc
aagcgcgccctcgaggcgatgaacgactacgacgtcgacaaggagcccgaaccggccgag
ggagagagcttcgcgcaggatccggaggagtacgagttccggtatttggaagacgtgatc
gcggagaacgagaccgcggacgtccgcaacatcgggaccaccttcgagaccaagcccgac
tggtgcgaccccgagcagatcgaccggatgctcgatctcggcggcacgaaggtcgaggtc
ggcgtccagaccacctacgagcgggtcaaccgggagatgcaccgcggccacggcgtccag
gagtcgatggacgccaaccagcggctgcgggactcggcctttaaggtcggcttccacatg
atgcccggccagcccgggatgtccaaggagatgtgtctcgaggacttccggcgcatcttc
gaggaagaggagtggaagcccgactacctcaaaatctacccgatgctaatcgtccgcgac
acggcgacctacgactggtggcaccgcggcgagttcgagccgctaggcaacgacgaggcc
gccgaactgatcgcggagatcaaggacatgatcccccgctacacgcgcctccagcgcgtc
cagcgggacatcccggcggacttcatcgacgccggcgtctggaagtccaacctccggcaa
ctcgcccgccagcgcatggaggaacacggctggtcctgcgactgtatccgctgtcgcgaa
gtcgggatgaacgacgaggaacccgagaacgtcgaactcgacgtcatgacctacgacgcc
tgcggcggcacggagcacttcatctccgtcgaggacttcgacaaggacctcctgatcggc
ttctgccggttgcggttcccgtcgaatccggtgcggccggaactcgagaacgccgccctg
atccgcgaactccacgtctacggcagcgaagtgaccatgggcgacgagggagagacggac
cagcaccagcacaggggctacggccgccgactgatggagaaggccgaggagctcgccgcc
gacgcgggctacgacaaggtcagcgtcatctccgggatcggcgcccgcgagtactaccgg
aacaaactcggctaccaccaggacgggccgtacgtgagcaagcggctctga

DBGET integrated database retrieval system