KEGG   Halopiger xanaduensis: Halxa_2473Help
Entry
Halxa_2473        CDS       T01532                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00260  Glycine, serine and threonine metabolism
hxa00750  Vitamin B6 metabolism
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01230  Biosynthesis of amino acids
Module
hxa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halxa_2473
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halxa_2473
Enzymes [BR:hxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halxa_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon DZR Zn-ribbon_8 HypA zf-LYAR
Motif
Other DBs
NCBI-ProteinID: AEH37092
JGI: Halxa_2473
UniProt: F8D8Y3
Position
1799319..1800518
Genome map
AA seq 399 aa AA seqDB search
MDLTTTDAFDGLECVDCGATFDAAEATHECPDCGGVLDPTYDYDAIDLDRETLESRPFDS
MWRYEELLPFARESAVTMDEGATALVDCPNLADELGVERVLVKDEGRNPTGTFKDRGQTV
AVTAATQHGASDVVLASAGNAGQAAAAYAGRAGLESHVFLPSRSGFTNKAMVNVHGGDMN
VVGGRIGDAGAAYEEAREEHDDWYPLQTFTTPYRHEGKKTMLYEIVEQLDWETPDAICYP
TGGGVGLIGMYKAATEFRELGLIDDLPALYAAQASGCAPIVEAYEEGWDEHEPVENPDTI
CGGLEIPDPGASPWILEAIRATDGGAVATDDPDILEAGVQVAQHAGLEMVPSSAAAASGA
WELAERGEFDGDETIVILNTGSGNKEADVLRSHLMGQGI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggacctgacgacgacggacgccttcgacggcctcgagtgcgtcgactgcggcgcgacc
ttcgacgccgccgaggcgacccacgagtgtccggactgcggcggggtgctcgatccgacc
tacgactacgacgcgatcgatctcgaccgcgagaccctcgagtctcggccgttcgactcg
atgtggcgctacgaggaactgttgccgttcgcccgcgagtcggcggtcacgatggacgag
ggcgcgacggcgctggtcgactgccccaatctggccgacgaactgggcgtcgaacgcgtc
ctcgtcaaggacgagggccggaatccgacgggaacgttcaaggaccgcggccagaccgtc
gccgtgacggccgcgacccagcacggcgcgagcgacgtcgtccttgcctccgccggaaac
gcgggtcaggccgccgcagcctacgccggccgtgcgggcctcgagtcgcacgtctttctg
ccctcgcgttccggcttcacgaacaaggcgatggtcaacgtccacggcggcgacatgaac
gtcgtcgggggccggatcggcgacgccggcgcggcctacgaggaggcccgcgaggagcac
gacgactggtacccgctccagacgttcactacaccctaccgccacgaggggaagaagacg
atgctctacgagatcgtcgagcaactcgactgggaaacgccggacgcgatctgttatccg
accggcggcggggtcggcctgatcggaatgtacaaggccgcgaccgagttccgggaactc
ggcctgatcgacgacttgccggcgctgtacgccgcgcaggcgtcgggctgtgccccgatc
gtcgaagcctacgaggaaggatgggacgaacacgaacccgtcgagaaccccgataccatc
tgcggcggcctcgagatccccgatccgggcgcgagcccgtggatcctcgaggcgatccgc
gcgaccgacggcggcgcggtcgcgacggacgatccggacatcctcgaggccggcgtccaa
gttgcccaacacgcgggcctcgagatggtgcccagctccgccgcagccgcgagcggcgcg
tgggaactggccgagcgcggcgagttcgacggcgacgagacgatcgtcatcctcaacacg
ggctcgggcaacaaggaggccgacgtgctgcggagccacctgatgggacagggtatctaa

DBGET integrated database retrieval system