KEGG   Halopiger xanaduensis: Halxa_2509Help
Entry
Halxa_2509        CDS       T01532                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hxa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hxa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hxa00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hxa00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hxa00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1832773..1833417
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPLEVAAAVRDVDEETDARIAVAPQAAHLERVAETGAETWAQHVDPID
YGSNTGHTLAETVADAGADGTLINHSEQRLKLADIDGAVRAAQRADLETIVCANNPAQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVDAAANVDDDVDVLCGAGISTGDDV
VAASDLGAEGVLLASGVAKADDPRAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacctacccctgcgacccgctcgaggttgcagcggcg
gtccgcgacgtcgacgaagaaaccgacgcgcgcatcgcggtcgcgccgcaggcggcccac
ctcgagcgcgtcgccgagacgggcgccgagacgtgggcccagcacgtcgatccgatcgac
tacggcagcaacaccggccacaccctcgcggagacggtcgccgacgccggcgccgacggg
acgctgatcaaccactccgaacagcggctgaaactcgccgacatcgacggtgcagttcgg
gcggcccagcgggccgacctcgagacgatcgtctgcgcgaacaaccccgcacagatcggc
gcggccgccgcgctcgggccggacgccgtcgccgtcgagccgccggaactcatcgggacc
gggacgccggtcagccaggccgaccccgatatcgtcgaggacgccgtcgacgccgcggcg
aacgtcgacgacgacgtggacgtcctctgtggcgccgggatcagcaccggcgacgacgtc
gtcgctgcgagcgacctcggcgccgagggcgttctactcgccagcggcgtcgcgaaggcc
gacgacccgcgggcggcgctcgaggacctcgtcgacccgctctga

DBGET integrated database retrieval system