KEGG   Halopiger xanaduensis: Halxa_2509Help
Entry
Halxa_2509        CDS       T01532                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00010  Glycolysis / Gluconeogenesis
hxa00051  Fructose and mannose metabolism
hxa00562  Inositol phosphate metabolism
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
hxa01200  Carbon metabolism
hxa01230  Biosynthesis of amino acids
Module
hxa_M00002  Glycolysis, core module involving three-carbon compounds
hxa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_2509
   00051 Fructose and mannose metabolism
    Halxa_2509
   00562 Inositol phosphate metabolism
    Halxa_2509
Enzymes [BR:hxa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halxa_2509
Exosome [BR:hxa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halxa_2509
  Exosomal proteins of bladder cancer cells
   Halxa_2509
  Exosomal proteins of melanoma cells
   Halxa_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS Hydrolase_like Glu_synthase NMO
Motif
Other DBs
NCBI-ProteinID: AEH37127
JGI: Halxa_2509
UniProt: F8DBK2
Position
1832773..1833417
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPLEVAAAVRDVDEETDARIAVAPQAAHLERVAETGAETWAQHVDPID
YGSNTGHTLAETVADAGADGTLINHSEQRLKLADIDGAVRAAQRADLETIVCANNPAQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVDAAANVDDDVDVLCGAGISTGDDV
VAASDLGAEGVLLASGVAKADDPRAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacctacccctgcgacccgctcgaggttgcagcggcg
gtccgcgacgtcgacgaagaaaccgacgcgcgcatcgcggtcgcgccgcaggcggcccac
ctcgagcgcgtcgccgagacgggcgccgagacgtgggcccagcacgtcgatccgatcgac
tacggcagcaacaccggccacaccctcgcggagacggtcgccgacgccggcgccgacggg
acgctgatcaaccactccgaacagcggctgaaactcgccgacatcgacggtgcagttcgg
gcggcccagcgggccgacctcgagacgatcgtctgcgcgaacaaccccgcacagatcggc
gcggccgccgcgctcgggccggacgccgtcgccgtcgagccgccggaactcatcgggacc
gggacgccggtcagccaggccgaccccgatatcgtcgaggacgccgtcgacgccgcggcg
aacgtcgacgacgacgtggacgtcctctgtggcgccgggatcagcaccggcgacgacgtc
gtcgctgcgagcgacctcggcgccgagggcgttctactcgccagcggcgtcgcgaaggcc
gacgacccgcgggcggcgctcgaggacctcgtcgacccgctctga

DBGET integrated database retrieval system