KEGG   Halopiger xanaduensis: Halxa_2509Help
Entry
Halxa_2509        CDS       T01532                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halxa_2509
   01230 Biosynthesis of amino acids
    Halxa_2509
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_2509
   00051 Fructose and mannose metabolism
    Halxa_2509
   00562 Inositol phosphate metabolism
    Halxa_2509
Enzymes [BR:hxa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halxa_2509
Exosome [BR:hxa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halxa_2509
  Exosomal proteins of bladder cancer cells
   Halxa_2509
  Exosomal proteins of melanoma cells
   Halxa_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1832773..1833417
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPLEVAAAVRDVDEETDARIAVAPQAAHLERVAETGAETWAQHVDPID
YGSNTGHTLAETVADAGADGTLINHSEQRLKLADIDGAVRAAQRADLETIVCANNPAQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVDAAANVDDDVDVLCGAGISTGDDV
VAASDLGAEGVLLASGVAKADDPRAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacctacccctgcgacccgctcgaggttgcagcggcg
gtccgcgacgtcgacgaagaaaccgacgcgcgcatcgcggtcgcgccgcaggcggcccac
ctcgagcgcgtcgccgagacgggcgccgagacgtgggcccagcacgtcgatccgatcgac
tacggcagcaacaccggccacaccctcgcggagacggtcgccgacgccggcgccgacggg
acgctgatcaaccactccgaacagcggctgaaactcgccgacatcgacggtgcagttcgg
gcggcccagcgggccgacctcgagacgatcgtctgcgcgaacaaccccgcacagatcggc
gcggccgccgcgctcgggccggacgccgtcgccgtcgagccgccggaactcatcgggacc
gggacgccggtcagccaggccgaccccgatatcgtcgaggacgccgtcgacgccgcggcg
aacgtcgacgacgacgtggacgtcctctgtggcgccgggatcagcaccggcgacgacgtc
gtcgctgcgagcgacctcggcgccgagggcgttctactcgccagcggcgtcgcgaaggcc
gacgacccgcgggcggcgctcgaggacctcgtcgacccgctctga

DBGET integrated database retrieval system