KEGG   Halopiger xanaduensis: Halxa_2526Help
Entry
Halxa_2526        CDS       T01532                                 

Definition
(RefSeq) acetate/CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halxa_2526
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_2526
   00620 Pyruvate metabolism
    Halxa_2526
   00640 Propanoate metabolism
    Halxa_2526
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Halxa_2526
   00680 Methane metabolism
    Halxa_2526
Enzymes [BR:hxa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halxa_2526
Lipid biosynthesis proteins [BR:hxa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halxa_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1847512..1849488
Genome map
AA seq 658 aa AA seqDB search
MVDRNGWGRDRPVPTGSPRSPPDWFARQANVTDEEIYETFERDWPDCWERAADLLSWDEP
YDTVLNDENAPFYEWFGGGKLNAAYNCVDRHLEAGRKNHVAIRWEGKHGEHETYTYRDLY
VEVNEFAAALRGLGVEEDDVVTIYLPMIPALPIAMLACARIGAPHSVVFAGLSADALATR
MDAAESEYLITCDGYYRRGDAFNQKSKADNARLSVEQDVETVVVDRLGDDLPHVLGDDER
DYHDLCREYAGETVDPVSRDAEDMLFLMYTSGTTGEPKGVVHATGGYLAHVAWTSHAVLD
ITPEDTYWCAADIGWITGHSYIVYGPLALGTTAVMYEGTPDYPDRDRLWEIVDRNAVDVF
YTAPTAIRAFMKWGSDYPDRHDLSSLRLLGSVGEPISPRPWNWYREHIGRGDCPVVDTWW
QTETGAVIVSTLPGIDEMKPGAAGPGLPGIDVAVVDEAGDPVEPGQAGYLTIGRPWPGMA
RTLYDGDDRFRSEYWDRFSDPDRDEWVYFSGDAAAIDEDGYVTVLGRIDDVINVSGRRLS
TMEIESAITDVDGVAEAAVVGRSSEATGTEIYAYVSTAGGHDPDATIRQRIVDSIESTIG
PIAKPSEIVFTPELPKTRSGKIMRRLLEDIANGEDLGDTSSLRNPEIVGEIQAESGTE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatcggaacgggtggggacgggatcggcccgtcccgaccgggtcgcctcggagc
cctcccgactggttcgcccggcaggcgaacgtcacggacgaggagatctacgagacgttc
gagcgggactggccggactgctgggagcgggcggccgacctcctctcgtgggacgagccg
tacgataccgttctgaacgacgagaacgcgcccttctacgagtggttcggcggcgggaaa
ctgaacgccgcctacaactgcgtcgaccgccacctcgaggcggggcggaagaaccacgtc
gcgatccgctgggaggggaaacacggcgagcacgagacctacacctaccgggacctgtac
gtcgaggtcaacgagttcgcggcggcgctgcgcgggctgggcgtcgaggaggacgacgtg
gtgacgatctacctgccgatgatccccgcgctgccgatcgcgatgttggcctgcgcccga
atcggcgcgccccacagcgtcgtattcgcggggctctcggccgacgcgctggcgacgcgg
atggacgccgccgagagcgagtacctgatcacctgcgacggttactaccgccgcggcgac
gccttcaaccaaaagagcaaggccgacaacgcccggctctcggtcgagcaggacgtcgag
accgtcgtcgtcgatcgcctcggggacgatctgccccacgtactcggcgacgacgagcgg
gactatcacgacctctgccgggagtacgccggcgaaaccgtcgaccccgtctctcgagac
gccgaggacatgctgttcctgatgtacacgtcgggcacgacgggcgaaccgaagggcgtc
gtccacgcgaccggcgggtacctcgcgcacgtcgcgtggacgagccacgccgtcctcgac
atcacgcccgaggacacctactggtgtgcggccgatatcggctggatcacgggccactcc
tacatcgtctacgggccgctggcactgggcacgacggcggtgatgtacgagggaacgccg
gactatcccgaccgggatcgactctgggagatcgtcgaccggaacgcggtcgacgtcttc
tacacggcgccgacggcgatccgcgcgttcatgaagtgggggtcggactaccccgaccgg
cacgatctgtcctcgctgcgactgctcgggtccgtgggcgagccgatcagcccccgcccg
tggaactggtaccgcgagcacatcggccgcggcgactgtccggtcgtcgacacctggtgg
cagaccgagaccggggcggtgatcgtctcgacgctgcccgggatcgacgagatgaaaccc
ggcgcggccggccccggacttccggggatcgacgtcgcggtcgtcgacgaagcgggcgac
cccgtcgaacccggccaggccggctacctcaccatcggccgcccgtggccgggcatggcg
cggacgctgtacgacggcgacgaccgcttccgctcggagtactgggaccggttctccgat
cccgaccgcgacgagtgggtctacttcagcggcgacgccgcggcgatcgacgaggacggc
tacgtcacggtgctcggccgcatcgacgacgtgatcaacgtctccggacggcgcctgagc
acgatggagatcgagagcgcgatcaccgacgtcgacggcgtcgccgaagccgccgtcgtc
ggccgctcgagcgaggcgaccggcaccgagatctacgcctacgtgagcacggcgggcggc
cacgacccggacgcgacgattcgacagcggatcgtcgacagcatcgagtcgacgatcggc
ccgatcgcgaagccgagcgagatcgtcttcacgccggaactgcccaagacccggtcgggc
aagatcatgcggcgactgctcgaggacatcgcgaacggggaggatctcggcgacacgagt
tcgctccggaacccggagatcgtcggcgaaatccaggccgagagcgggaccgagtag

DBGET integrated database retrieval system