KEGG   Halopiger xanaduensis: Halxa_2554Help
Entry
Halxa_2554        CDS       T01532                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hxa  Halopiger xanaduensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halxa_2554
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Halxa_2554
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Halxa_2554
Two-component system [BR:hxa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Halxa_2554
Bacterial motility proteins [BR:hxa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Halxa_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1872618..1873958
Genome map
AA seq 446 aa AA seqDB search
MTRVLVVDDSQFFRTVVGNALSDADYDVETADTGTEAVEIVRDAAFDPDVVTMDVEMPDM
NGIAAVERIMAATPTPVIMASAYTDTGAEATLDALEAGAIDFLQKPDGSGSRNIAHFVDD
LREKIDRLDDVDVSSLAEVRPTSSETRSESTVRSASHSDASPRSRSHSPAARADRSSPST
VGTAGTTSRGETAVESIAPADLETDTDAQRTAAAVPERSDDPASAVSLDSADDGTRGPTI
VVGASTGGPKIVERLLQRLPIGLDATVLIVQHMPADFTGRFADRLDAMGPYAVSEAGDGD
RVGPGEAVVAPGSAHLEIGADFGDSLRVRLDEARRDYGIQPAIDVTMETAADRVDGPLCG
VVLTGMGDDGAAGIEAIKAAGGRTIAQDEATSPVFGIPCQAIETGCVDSVAPAPEIVDEI
IAAFADATPEPDPNPDPDAKAGDRDD
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagtactcgttgtcgacgactcgcagttcttccggacagtcgtcggcaacgcg
ctcagcgacgccgattacgacgtcgaaacggccgataccggtaccgaggcggtcgaaatc
gtgagagacgcggcattcgatcctgacgtagtgaccatggacgtcgagatgccggacatg
aacggcatcgcggccgtcgagcggatcatggcagcgacgccgacgccggtcatcatggcc
agcgcgtataccgatacgggtgcggaggcgaccctcgatgcgctggaagccggcgcgatc
gacttcctccagaagcccgacgggtcgggctcgcgcaacatcgctcacttcgtggacgac
ctccgcgagaagatcgatcgactggacgacgtcgacgtgtcgtccctcgccgaggtccga
ccgacgagcagtgagacgcgctcggaatcgaccgttcgttctgcatctcactcggacgct
tctcctcgctctcgctcgcactcgcccgcggcacgcgccgaccgctcgagtccgtcgacg
gtcggtaccgccgggacgacgtcgcgaggtgagacggcggtcgaatcgatcgcaccggcc
gatctggaaacggataccgacgcgcaacggactgcggcggctgtgcccgagcgcagcgac
gatccggcgtccgcggtcagtctcgacagtgcagacgacggaacgcgcggcccgacgatc
gtcgtcggcgcctcgacgggcggtccgaagatcgtcgaacggctgctccagcggctcccg
atcggcctcgacgcgacggtgctgatcgtccagcacatgccggccgacttcaccgggcga
ttcgccgatcgactcgacgcgatggggccgtacgcggtcagcgaggccggcgacggcgac
cgggtcggccccggcgaggcggtcgttgcacccggcagcgcccacctcgagatcggcgcc
gacttcggcgactcgcttcgcgtccgcctcgacgaagcgcgccgcgactacgggatccag
ccggcgatcgacgtcacgatggaaacggccgccgaccgcgtcgacggaccgctctgtggc
gtcgtcctgaccggcatgggcgacgacggcgccgccggcatcgaggcgatcaaagctgca
ggtgggcgaaccatcgcacaggacgaggcgacgagccccgttttcggcatcccctgtcag
gcgatcgaaaccggctgcgtcgattcggtcgctcccgcccccgagatcgtcgacgagatc
atcgccgcgttcgcggacgcgacgcccgagccggacccgaacccggacccggacgcgaaa
gcgggtgaccgcgatgactga

DBGET integrated database retrieval system