KEGG   Halopiger xanaduensis: Halxa_2576Help
Entry
Halxa_2576        CDS       T01532                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hxa  Halopiger xanaduensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halxa_2576
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halxa_2576
   00650 Butanoate metabolism
    Halxa_2576
  Energy metabolism
   00190 Oxidative phosphorylation
    Halxa_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1899073..1899438)
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFAPGGTRWLLQRITAAFLVVVLAFHFFQLHFVTHAAEVTFMGTQARMQNVGYF
LTMVLFLITAAFHGVNGVYNALINQGLEGTRKKVVLAVLVIAGGALIAQGVYVAVAMAGW
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacggtattcctcgttcgcgcccggcggaacccgctggttgctccagcggatc
acggcggcgtttctggtcgtcgtgctcgccttccacttcttccaactgcacttcgtcacc
cacgccgcggaggtgaccttcatgggcacgcaagcgcgcatgcagaacgtcggctacttc
ctgacgatggtgctgttcctgatcacggccgcgttccacggcgtcaacggcgtctacaac
gccctgatcaaccagggactcgagggcacccggaagaaagtagtgctcgcagtccttgtc
atcgctggcggcgcactgatcgcgcagggagtctacgtcgcagtcgctatggcggggtgg
atctaa

DBGET integrated database retrieval system