KEGG   Halopiger xanaduensis: Halxa_2576Help
Entry
Halxa_2576        CDS       T01532                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00020  Citrate cycle (TCA cycle)
hxa00190  Oxidative phosphorylation
hxa00650  Butanoate metabolism
hxa00720  Carbon fixation pathways in prokaryotes
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
hxa01200  Carbon metabolism
Module
hxa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hxa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hxa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halxa_2576
   00650 Butanoate metabolism
    Halxa_2576
  Energy metabolism
   00190 Oxidative phosphorylation
    Halxa_2576
   00720 Carbon fixation pathways in prokaryotes
    Halxa_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF4536
Motif
Other DBs
NCBI-ProteinID: AEH37194
JGI: Halxa_2576
UniProt: F8DC76
Position
complement(1899073..1899438)
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFAPGGTRWLLQRITAAFLVVVLAFHFFQLHFVTHAAEVTFMGTQARMQNVGYF
LTMVLFLITAAFHGVNGVYNALINQGLEGTRKKVVLAVLVIAGGALIAQGVYVAVAMAGW
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacggtattcctcgttcgcgcccggcggaacccgctggttgctccagcggatc
acggcggcgtttctggtcgtcgtgctcgccttccacttcttccaactgcacttcgtcacc
cacgccgcggaggtgaccttcatgggcacgcaagcgcgcatgcagaacgtcggctacttc
ctgacgatggtgctgttcctgatcacggccgcgttccacggcgtcaacggcgtctacaac
gccctgatcaaccagggactcgagggcacccggaagaaagtagtgctcgcagtccttgtc
atcgctggcggcgcactgatcgcgcagggagtctacgtcgcagtcgctatggcggggtgg
atctaa

DBGET integrated database retrieval system