KEGG   Halopiger xanaduensis: Halxa_2610Help
Entry
Halxa_2610        CDS       T01532                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halxa_2610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_2610
   00052 Galactose metabolism
    Halxa_2610
   00500 Starch and sucrose metabolism
    Halxa_2610
   00520 Amino sugar and nucleotide sugar metabolism
    Halxa_2610
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halxa_2610
   00524 Butirosin and neomycin biosynthesis
    Halxa_2610
Enzymes [BR:hxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halxa_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1933710..1934687
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAAVAEGDGTTIGVSRNATPRGPTGIDVTEGVLRTLREACTDAGIE
PDQIVSAGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPIEKLIDSDEVYLHNDTAAGV
IGERFHADRNPDDMVYITVSSGIGAGVCCDGDILAGWDGNAGEVGHCIVDPRGRLTCGCG
HDGHWEAYCSGNGIPDYVRLLAEDDPTISTDLPLDDPDFTAKDVFELAGEDELADYAIDQ
LAHWNAMGVANVVHSFAPIVVSFGGAVALNNEELVVKPIRERVSEMVMSNVPEIRVTDLG
DDVVLEGALASAMTEGTGDRRRFQG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactacgcgggcgtcgacctcggggcgacgaacgtgcgggcggccgtcgccgag
ggcgacgggacgacgatcggcgtcagccggaacgccacgccgcgcggccccacgggcatc
gacgtgacggagggagtcctccggacgctgcgggaagcctgcaccgacgccgggatcgaa
ccggatcagatcgtctcggcggggatcggctcgatcggccccttcgacctcgcggaggga
gcggtgatcgatccggccaacctgccggactcgatcgaccggattccgctgaccggcccc
atcgagaaactgatcgacagcgacgaggtctacctccacaacgacaccgccgcgggcgtc
atcggcgagcggttccacgccgaccgcaaccccgacgacatggtctacatcaccgtctcc
tcggggatcggcgccggcgtctgctgcgacggcgacatcctggccggctgggacggcaac
gccggcgaggtcggccactgcatcgtcgacccgcgcgggcggctcacctgcggttgcggc
cacgacggccactgggaggcgtactgttccgggaacgggatcccggactacgtccgacta
ctcgctgaagacgacccgacgatttcgaccgacctacccctcgacgaccctgattttacc
gcgaaagacgtcttcgaactcgccggcgaggacgaactggccgactacgcgatcgaccaa
ctggcccactggaacgcgatgggtgtagcgaacgtcgtccactccttcgccccgatcgtc
gtctccttcggcggcgccgtcgcgctcaacaacgaggaactggtcgtaaagccgatccgc
gagcgcgtctcggagatggtgatgagcaacgtccccgagatccgcgtgaccgatctcggc
gacgacgtcgttctcgagggggcgctcgcgagcgcgatgaccgagggaaccggcgaccgg
cggcggttccaggggtaa

DBGET integrated database retrieval system