KEGG   Halopiger xanaduensis: Halxa_2625Help
Entry
Halxa_2625        CDS       T01532                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00790  Folate biosynthesis
hxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halxa_2625
Enzymes [BR:hxa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Halxa_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Mur_ligase_M Mur_ligase_C PEP_mutase CAT_RBD
Motif
Other DBs
NCBI-ProteinID: AEH37243
JGI: Halxa_2625
UniProt: F8DCR9
Position
complement(1950177..1952675)
Genome map
AA seq 832 aa AA seqDB search
MEYHEAADALFGLRRFRPKPGTESTARLLAHLGNPHEDVDFVQVAGSNGKGSTARMLERT
LREAGLSVGLYTSPHLEELRERVRVDGRKIPRSAVCEFVDSTQDYLTDRAADGESPTFFE
TMTALALWQFDREDVDVAVLEVGIGGKFDATSVVDPIASAVTSVTLEHTGILGDTEEEIA
RDKAHVAPDEAPLVTGVSGDPLEAVRDVAGDVVTVGFADEDPEPDVRVEYGGRTNHTEAA
VSIDADEWGVETRVPLPGEHQAENAGIAATLARQVAGVSTDDIARGLRSAHWPGRFEVID
TEPLVVLDGAHNPGACETLASTLGSYEYDDLRVVFGAMHDKDHREMAAALPTPDAVVATE
PSLDRAEDPAVLADVFDDAGVEDVRIEGAVQAALETALSEADRSDCVLVTGSLFAVAEAR
RRWTRTEISKRIRDRSDAREALAGANVPEASVRQLSGQGVHRVVRTRLQRRQATLVKEEL
LRVGGECALSGLQRDDEPVDTLLMGTFAQFERLVDRLESDADARSLGLAELAAELRGTLE
ISDAGAPPNEFVANQSPLSRSPWPWFDRTAVMGILNVTPDSFHDGGEYDAVEDAVARAEA
MVEAGADVLDVGGESTRPGADPVSTEEEIDRVVPVLERVRDFDIPISIDTRKAAVADAAL
EAGADIINDVSGLEDPEMRFVAADHDAGLIVMHSINAPVVPGQEVTYDDVVEDVIDQLSE
RVLLAEKAGVDRENIVVDPGIGFGKSARESFEILDRLEEFRALGCPVLFGHSHKSMFEHV
GSEAGDCLDATVAASALAADRGADLVRVHDVPENVAAVRTALATRNPDRFEW
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcacgaggcggcggacgcgctcttcggtctgcgacggttccgcccgaaaccg
gggacggagtcgaccgcgcggctcctcgcccacctcgggaacccacacgaggacgtcgat
ttcgtgcaggtcgccggctccaacgggaaagggagcacggcgcggatgctcgagcggacg
ctccgggaagccgggctctcggtgggactgtacacctcgccgcacctcgaggaactgcgc
gagcgggtgcgggtcgacgggcgcaagatcccccggtcggccgtctgcgagttcgtcgac
tcgacgcaggactacctcacggaccgggccgccgacggggagtcgcccaccttcttcgag
acgatgaccgcgctggcgctctggcagttcgaccgcgaggacgtcgacgtggccgtcctc
gaggtcggcatcggcgggaagttcgacgccacgagcgtcgtcgatccgatcgcgagcgcg
gtcaccagcgtcaccctcgagcacacgggcatcctcggcgacaccgaggaagagatcgcc
cgcgacaaagcccacgtcgccccggacgaggcgccgctcgtgaccggcgtctcgggcgac
ccgctcgaggcggtccgagacgttgccggcgacgtcgtcacggtcggcttcgccgacgag
gaccccgaacccgacgtccgcgtcgagtacggcggccggacgaaccacaccgaagcggcc
gtctcgatcgacgccgacgagtggggtgtcgagacgcgcgtgccgctaccgggcgagcac
caggccgagaacgccgggatcgccgcgacgctcgcgcggcaggtcgccggcgtttcgacc
gacgacatcgcccgcgggctgcgcagcgcccactggccgggccggttcgaggtgatcgac
accgagccgctggtcgtcctcgatggcgcgcacaatcccggcgcctgcgagacgctcgcg
tcgacgctcggcagctacgagtacgacgacctccgcgtcgtcttcggcgcgatgcacgac
aaggaccaccgggagatggccgcggcgctgccgacccccgacgcggtcgtcgcgacggaa
ccctccctcgaccgcgccgaggatccggccgtcctcgccgacgtgttcgacgacgccggc
gtcgaagacgtccgcatcgagggtgccgtgcaggccgccctcgagacggccctttccgag
gccgatcgatccgactgcgtgctcgtcaccggctcgctgttcgcggtcgccgaggcgcgc
cggcggtggactcgcaccgagatttcgaagcgcatccgcgaccgctcggacgcccgcgag
gcgctcgcaggtgcgaacgttcccgaggccagcgtccggcaactgagcgggcagggcgtc
caccgcgtcgtgcgcacgcgcttgcagcgacggcaagcgacgctggtgaaggaggaattg
ctgcgcgtcggcggcgagtgtgcgctctcagggctccagcgggacgacgaacccgtcgac
accctcctgatggggacgttcgcgcagttcgaacgcctcgtcgaccgcctcgagtcggac
gccgacgcgcggtcgctggggctcgccgaactcgccgcggaactgcggggaacgctcgag
atcagcgacgctggcgcccctccaaacgagttcgtagccaatcagtcgccgctgtcgcgg
tcgccgtggccgtggttcgatcgcaccgccgtgatgggcatcctgaacgtcacgcccgac
agcttccacgacggcggcgagtacgacgccgtcgaggacgccgtcgcccgcgcggaggcg
atggtcgaggccggcgccgatgtgctcgacgtcggcggcgagtcgacccgtcccggcgcc
gaccccgtttcgaccgaggaggagatcgaccgcgtcgtgcccgtcctcgagcgggtccga
gacttcgacatcccgatctcgatcgacacccgcaaggccgccgtcgccgacgcggccctc
gaagccggcgccgatatcatcaacgacgtctcggggctcgaggaccccgaaatgcggttc
gtcgcggccgaccacgacgcggggctgatcgtgatgcacagcatcaacgcgccggtcgtc
ccgggacaggaggtgacctacgacgacgtcgtcgaggacgtcatcgaccagctttccgag
cgggtgctgctcgcggagaaggcgggcgtcgaccgcgagaacatcgtcgtcgatcccggc
atcggcttcggcaagtcggcccgcgagagcttcgagattctcgaccggctcgaggagttc
cgcgcgctgggctgtccggttctcttcgggcactcccacaagtcgatgttcgagcacgtc
ggcagcgaggccggcgactgcctcgacgcgacggtcgcggcgagcgcgctcgcggccgac
cgcggggccgacctcgtccgcgtccacgacgttcccgagaacgtcgccgcggtccggacg
gcgctcgcgacgcggaatccggatcgcttcgagtggtag

DBGET integrated database retrieval system