KEGG   Halopiger xanaduensis: Halxa_3269Help
Entry
Halxa_3269        CDS       T01532                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hxa  Halopiger xanaduensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hxa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2604223..2605359
Genome map
AA seq 378 aa AA seqDB search
MTTPTLRGADAETVRDALERSEPLPGTAGFAGEVDGRLVRDVLGREPLFLESADADVGAD
SDAWAFEPAPLEDPAPFPAGGVLDADEAGRVEPDGVERRFTLPDPDPEPDHEAALEALDD
AIRTATDAARTADREIAVAFSGGVDSALVAELLDAPLYVVGFPDSHDVEAARTAAEAMGR
DLTVVELEPADLERAVPEIVRATGRTNAMDVQIALPLYLVGERVAADSYDALAVGQGADE
LFGGYEKVVRLDHRVEAETTRGAVREQIESLPDQLPRDVLTIRATGLEPVAPLLHDRVVE
AALRLPDDLLADEETRKRGFRQVAARYLPGEVAERDKKAVQYGSLVARELDRLARQHGYK
RRMDDHVSKYIESLLADE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgccgaccctccgcggcgccgacgccgagaccgttcgcgacgccctcgagcgc
agcgagccgctgcccggaaccgccggcttcgcgggcgaggtcgacgggcgactcgtccgg
gacgtgctcgggcgcgagccgctgtttctcgagtcggccgacgcggacgtcggagcggac
agcgacgcgtgggcgttcgaaccggcgccgctcgaggatcctgcgccgttcccggcgggc
ggagtgctggacgccgacgaggcggggcgcgtcgaaccggacggcgtcgagcgccgcttt
acgcttcctgatcccgaccccgaaccggatcacgaggccgccctcgaggcgctcgacgac
gcgatccggacggcgaccgacgcggcccgaaccgcggaccgcgagatcgccgtcgccttc
tccggcggcgtcgactccgcgctggtcgccgaactgctggacgcgccgctgtacgtcgtc
ggcttccccgacagccacgacgtcgaggccgcgcgcacggccgccgaggcgatgggacgg
gatctgaccgtcgtcgaactcgagccagccgacctcgagcgcgcggtgcccgagatcgtc
cgcgcgacggggcggacgaacgcgatggacgtccagatcgccctgccgctgtacctggtc
ggcgaacgggtcgccgcggacagctacgacgcgctggcggtcggtcagggcgccgacgaa
ctgttcggcggctacgagaaggtcgtccggctcgaccaccgcgtcgaggcggagacgacc
cgcggggccgtccgcgaacagatcgagagtttgcccgaccagcttccccgcgacgtgctg
acgatccgggcgaccggcctcgagccggtcgctcccttactccacgaccgcgtggtcgag
gcggcacttcggctgccggacgacctgctggccgacgaggagacgcggaagcgcggcttc
cggcaggttgcggcccggtacctccccggcgaggtcgccgagcgggacaaaaaggcggtc
cagtacggcagcctcgtcgcccgcgaactcgaccggctcgcccgacagcacggctacaag
cgacggatggacgaccacgtctcgaagtacatcgaatcgctgctcgcggacgagtaa

DBGET integrated database retrieval system