KEGG   Halopiger xanaduensis: Halxa_3592Help
Entry
Halxa_3592        CDS       T01532                                 

Definition
tRNA-guanine transglycosylase
Orthology
K07557  
archaeosine synthase [EC:2.6.1.97]
Organism
hxa  Halopiger xanaduensis
Brite
Enzymes [BR:hxa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.97  archaeosine synthase
     Halxa_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2917278..2919029
Genome map
AA seq 583 aa AA seqDB search
MTEYFEVHERDGAARVGELRLAESHTTPALVDDLLEDAGSLWSRAREVPEGDESKLTVLP
HRAFPGGTADEVQESFAVDYPDVDYPSVAVVSSDHVEDHGTDAYAVSDVQSAMGHGAALV
EAVVNVREEIPTDTALLFSGVTTPRNVALLAYAGVDLFDATAAVVKGTEGRYLTTDEAYF
LEDLDELPCSCPACQKPREEFTREDCAEHNRNALESELAIVRRRIRDGRLRDYVEGQARH
DQWLTAGMRELDQQWGYLEERTPILRDAQISAATEDTLRRVEIQRFADRVTTRYRNRFDN
PLVLVPCSATKPYSESQSHRQFHDVIQWRAHLVSMTSPIGVVPQELETTYPAQHYDTVVT
GRWSEDEKQFVSEVLRRYLERNEYPEIIAHVPDEGYRDIVERVEDELELDITYTVAEHPT
DDESLANLSEALSGELKYSKREREHNTVRAIADYLLGDGAGDDLFENIQTTSRYPKIQVR
DSEDTQLATMVPQYGTLSFTLEGARRWLESDAPVKRVEIDGFVPHGSVLAPGVVDADEDI
RVGDEVVVEGPKAFAIGRAEMFGREMAESTRGVAAEVRHVEEK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtatttcgaagtgcacgagcgcgacggggccgcgcgcgtgggcgagttgcga
ctcgccgagtcccacacgacccccgcgctcgtcgacgacctgctcgaggacgcgggctcc
ctgtggagccgggcccgcgaggtgcccgagggcgacgaatcgaaactcaccgtcctgccg
caccgcgcgttccccggcggcaccgccgacgaagtgcaggaatccttcgccgtcgactat
ccggacgtcgactaccccagcgtcgccgtcgtctcgagcgaccacgtcgaggaccacggc
accgacgcgtacgccgtctcggacgtccagtccgcgatgggccacggtgcggcgctggtc
gaggccgtcgtcaacgtccgcgaggagattccgaccgacaccgcgctgctcttctcgggc
gtcacgacgccgcgcaacgtcgccctgctggcctacgccggcgtcgacctcttcgacgcg
acggcggccgtcgtcaaggggacggagggccgctacctcaccaccgacgaggcctacttc
ctcgaggatctcgacgaactgccctgttcctgtccggcctgtcaaaaaccgcgcgaggag
ttcacccgcgaggactgcgccgagcacaatcgcaacgccctcgagtcggaactcgcgatc
gttcgccggcggatccgcgacggtcgcctgcgcgactacgtcgagggccaggcccgacac
gaccagtggctcaccgccggcatgcgcgaactcgaccagcaatggggctacctcgaggag
cgcacgccgattctccgggacgcccagatcagcgccgccaccgaggacaccttgcgacgc
gtcgaaatccagcggttcgccgaccgagtaacgacgcggtaccgcaaccggttcgacaac
ccgctcgtgctggtcccttgctcggcgaccaaaccctacagcgagtcccagagccaccgc
cagttccacgacgtcatccagtggcgcgcccacctggtctcgatgacgtcaccgatcggc
gtcgtcccgcaggaactcgagacgacctacccggcccagcactacgacaccgtcgtcacg
ggtcgctggtccgaagacgaaaaacagttcgtcagcgaggtgctgcgacgctacctcgag
cgcaacgagtaccccgaaatcatcgcgcacgtccccgacgagggctaccgcgacatcgtc
gagcgcgtcgaggatgaactcgagctcgatatcacctacaccgtcgcggaacacccgacc
gacgacgagtcgctcgcgaacctctccgaggcgctctcgggcgaactcaagtactccaag
cgcgagcgcgagcacaacaccgtccgcgccatcgcggactacctgctgggcgacggcgcc
ggcgacgacctcttcgagaacattcagacgacgagccgctacccgaagattcaggtccgc
gacagcgaagacacgcaactcgcgacgatggtgccccagtacggcaccctctcctttacg
ctcgagggggcgcgccgctggctcgagagcgacgcgccggtcaagcgcgtcgagatcgac
ggcttcgtcccgcacggcagcgtgctcgcgccgggcgtcgtcgacgccgacgaggacatc
cgcgtcggcgacgaggtcgtcgtcgaggggccgaaggccttcgccatcggccgcgccgag
atgttcggccgcgagatggccgagagcacgcggggcgtcgcggccgaagttcgtcacgtc
gaggagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system