KEGG   Halopiger xanaduensis: Halxa_3850Help
Entry
Halxa_3850        CDS       T01532                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00010  Glycolysis / Gluconeogenesis
hxa00620  Pyruvate metabolism
hxa00640  Propanoate metabolism
hxa00680  Methane metabolism
hxa00720  Carbon fixation pathways in prokaryotes
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
hxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_3850
   00620 Pyruvate metabolism
    Halxa_3850
   00640 Propanoate metabolism
    Halxa_3850
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Halxa_3850
   00680 Methane metabolism
    Halxa_3850
Enzymes [BR:hxa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halxa_3850
Lipid biosynthesis proteins [BR:hxa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halxa_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH38455
JGI: Halxa_3850
UniProt: F8DCY7
Position
3191045..3193057
Genome map
AA seq 670 aa AA seqDB search
MPDGSGIMSEESNEGEADVELEARLAEQEAFEPPESFVEQANVTDEGIYEEFEENWPECW
EQAADLLSWEEEYDAVLNDEDAPFYEWFTDGKLNASSNCLDRHVENGAKNRAAIKWEGEM
GETRTYTYGELLNEVEAFAAGLRDIGVEEDDVVTLYLPMIPELPIAMLACARIGAPHSVV
FAGFSADALAMRMNAADSEYLITCDGYYRRGDALNHKEKADKGLRSVDQDVTSVVVDRLG
EELTHFLGNDARDYDELVAEHEGASVEPVTRDAEDMLFLMYTSGTTGEPKGVKHTTGGYL
AYTAWTSQAVLDLVPEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDYPERDRL
WEIIEKNRVDVFYTAPTAIRAFMKWGSDYPEQHDLSSLRLLGTVGEPINPRAWKWYYKHI
GDEECPIVDTWWQTETGGMMITTLPAINTMKPGSAGPPLPGVSATVVDAAGEEIEAGEAG
YVTVDKPWPGMLRTLYENDDRFIEEYWTEYSDEAADEWVYFPEDGAKIDDDGYITILGRV
DDVINVSGHRLGTMEIESAIVGVSGVAEAAVVGGDHDVKGEAVYAYVILEDGQEPTDDMR
DRIVAAVEDAIGPIARPEEVLFTPELPKTRSGKIMRRLLEDIASGNELGDTSTLRNPEIV
EEIADQIDSE
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatggttccggtatcatgagcgaagaaagcaacgagggcgaggccgacgtcgaa
ctcgaggctcgcctggcggaacaggaagcgttcgagcccccggaatcgttcgtcgagcag
gcgaacgtcacggacgagggcatctacgaggagttcgaggagaactggccggagtgctgg
gagcaggcggccgacctcctctcgtgggaggaggagtacgacgcagtcctgaacgacgag
gacgcgcccttctacgagtggttcaccgacgggaagctgaacgcctcgtccaactgtctc
gacaggcacgtcgagaacggcgcgaagaaccgcgcggcgatcaagtgggagggcgagatg
ggggagacccggacctacacctacggcgaactgctgaacgaggtcgaagcgttcgccgca
gggctccgggacatcggcgtcgaggaggacgacgtcgttaccctgtacctcccgatgatc
ccggagctgccgatcgcgatgctcgcctgcgctcgcatcggcgcgccccacagcgtcgtc
ttcgccgggttctccgcggacgcgctcgcgatgcggatgaacgccgcggacagcgagtac
ctgatcacctgcgacggctactaccgccgcggcgacgcgctcaaccacaaggagaaagcc
gacaagggccttcgaagcgtcgaccaggacgtcaccagcgtcgtcgtcgaccggctgggc
gaggaactcacgcacttcctcggcaacgacgcccgcgactacgacgaactggtcgccgag
cacgagggcgcgtcggtcgaacccgttacgcgggacgccgaggacatgctgttcctcatg
tacacctcggggacgaccggcgaaccgaagggcgtcaagcatacgaccggcgggtacctc
gcgtacacggcctggaccagccaggcggtactcgacttggtgcccgaggacacctactgg
tgttcggccgatatcggctggatcaccggacactcctacatcgtctacgggccgctggca
ctgggcacgacgacggtgatgtacgagggaacgcccgactatccggaacgcgatcggctc
tgggagatcatcgagaagaaccgcgtcgacgtcttctacacggcgccgacggcgatccgt
gcgttcatgaagtggggatcggactaccccgagcaacacgacctgtcctcgctgcgacta
ctggggaccgtcggcgaaccgatcaacccgcgggcctggaagtggtactacaagcacatc
ggcgacgaggagtgtccgatcgtggatacgtggtggcagaccgagacgggcggcatgatg
atcacgacgctgccggcgatcaacacgatgaaacccggctccgccgggccgccgctgccg
ggcgtcagcgccaccgtcgtcgacgccgctggcgaagaaatcgaggccggcgaggccggc
tacgtcacggtcgacaagccgtggcccggcatgctccgaacgctgtacgagaacgacgac
cggttcatcgaggagtactggaccgagtattccgacgaggcggccgacgagtgggtctac
ttccccgaggacggcgccaagatcgacgacgacggctacatcacgatcctcgggcgcgtc
gacgacgtgatcaacgtctccggccaccgactggggacgatggagatcgagtccgcgatc
gtcggcgtctccggcgtcgccgaggccgccgtcgtcggcggcgaccacgacgtcaagggc
gaggccgtctacgcctacgtcatcctcgaggacggccaggagccgaccgacgacatgcgc
gaccggatcgtcgcggccgtcgaggacgccatcggtccgatcgcccggccggaggaagtg
ctctttacgcccgaactgcccaagacgcgctcgggcaagatcatgcgccggctgctcgag
gacatcgcgagcggcaacgaactcggcgacacgtcgacgctgcgtaatcccgagatcgtc
gaggagatcgccgaccagatcgactccgagtga

DBGET integrated database retrieval system