KEGG   Halopiger xanaduensis: Halxa_3885Help
Entry
Halxa_3885        CDS       T01532                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hxa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hxa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hxa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hxa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hxa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3226766..3228865)
Genome map
AA seq 699 aa AA seqDB search
MPEHTDTDANADGDGDLETVDEDAHEPDPEFVESANVYDFMETYGIDDYEDLIERTTTDL
EGIEESGLEWFWDEVVDYLGIEFDEDYDEIRDDSDGPQFTDWYVGGELNVAHNVVDRHAA
VDEERRNNVATIWEGEDGEVREVTYHELHRRVNQVANALEERGVETGDTVGLYMPMVPEV
VAILYGCLKVGAIAVPIFSGFGVDAVATRLEDAECSVLFTGDGFYRRGDPVFLKSTADKA
IEQAGHVEHAIVFDRLGSSNTRNEHEIPWTDGRDEWWEMAVETQDDAYETKSLPSSHESM
LLYSSGTTGKPKGIVQTHAGVQVQCAKEVYFGMDLKPADRFFWVSDIGWMMGPWTLIGTH
TFGGTVFMYEGAPNYPDPDRFWAMIDRHSLTQFGISPTAVRALRKHGERQTASDEPSGSV
GVGEDEWLEDHDLSSLRILGSTGEPWDPESWRWFYENVGNGECPIINISGGTEICGCFLM
PMPIQSLKPCTLGGPGLGMDIDIVDEEGNSVKDDNERGYLVARSSCPSMTKSLWAGDERY
LEEYWSTWEDLWDHGDWAQRDEDGFWFLHGRADDALNVAGRKVGPAEVEGALIDHEAVNQ
AAAIGAPDETTGTAVVAYVVLEDGYEASDDLREELRAQVGAELGKPFRPREVLFVDEFPK
TQSGKIVRRAIEATYTGDDPGDLSSIENPETIEELDRLR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcacaccgacaccgacgcaaacgctgacggcgacggcgatctcgagaccgtc
gacgaagacgcccacgaacccgatcccgagttcgtcgagtcggcgaacgtctacgacttc
atggagacgtacgggatcgacgactacgaggacctgatcgagcggacgacgaccgatctc
gaggggatcgaagaatcgggcctcgaatggttctgggacgaggtggtcgactacctcgga
atcgaatttgacgaagactacgacgagatacgggacgacagcgacgggccgcagttcacc
gactggtacgtcggcggcgaactcaacgtcgcccacaacgtcgtcgaccgacacgccgcc
gtcgacgaggaacggcggaacaacgtcgcgaccatctgggagggcgaggacggcgaagtt
cgcgaggtaacctaccacgaactccaccgccgggtgaatcaggtcgcgaacgccctcgag
gaacgaggcgtcgagacgggcgacaccgtcggcctctacatgccgatggttccggaggtc
gtcgcgatcctctacggctgtctcaaggtcggcgcgatcgcggtgccgatcttctccggc
ttcggcgtcgacgcggtcgcgacgcggctcgaggacgcggagtgttcggtgctgttcacg
ggcgacggcttctaccggcggggcgatccggtcttcctcaagtcgacggccgacaaggcg
atcgaacaggcggggcacgtcgagcacgcgatcgttttcgacaggctcggtagcagtaac
acgcgcaacgagcacgaaattccctggaccgacggccgtgacgagtggtgggaaatggcc
gtcgagacgcaggacgacgcctacgagacgaaatcgctgccctcgagccacgagtcgatg
ctgctgtactcgtcggggacgacgggaaaaccgaaggggatcgtccagactcacgcgggc
gtgcaggttcagtgcgccaaggaggtctacttcggaatggatctcaaacctgccgatcgg
ttcttctgggtctcggacatcggctggatgatggggccgtggacgctgatcgggacccac
accttcggcggcaccgtgttcatgtacgagggggcgcccaattaccccgatccggaccgg
ttctgggcgatgatcgatcggcacagcctgacgcagttcggcatctcgccgaccgccgtc
cgggcgctccgcaagcacggcgaacgtcagactgcgtctgacgagccgtccggctccgtg
ggagtcggagaggacgagtggctcgaggatcacgacctctcctcgctgcgcatactgggt
tcgacgggcgaaccctgggatcccgagtcctggcgctggttctacgagaacgtcggaaac
ggggagtgcccgatcatcaacatctccggcggcaccgagatctgtggctgcttcctgatg
ccgatgccgatccagtcgctcaaaccctgcacgctgggcggccccggcctcgggatggac
atcgacatcgtcgacgaggagggcaactccgtgaaggacgacaacgagcgcggctacctc
gtcgctcgtagctcctgtccctccatgacgaagtcgctgtgggcgggcgacgagcgctac
ctcgaggagtactggtcgacctgggaggatctgtgggatcacggcgactgggcccagcgg
gacgaagacggcttctggttcctccacggccgcgccgacgacgccctgaacgtcgccggc
cgcaaggtcggccccgccgaagtcgaaggtgcgctgatcgaccacgaggccgtcaaccag
gccgcggcgatcggcgcgccggacgagacgacagggacggcggtcgtcgcgtacgtcgtc
ctcgaggacggctacgaggcgtcggatgacctccgcgaggaactccgggcgcaggtcggc
gccgagttgggcaaaccgttccgcccgcgcgaggtgctgttcgtcgacgagttccccaaa
acccaatcggggaagatcgttcgccgcgccatcgaggcgacctacaccggcgacgatccg
ggcgacctgagcagcatcgagaatccggagacgatcgaggaactcgatcgcctccgataa

DBGET integrated database retrieval system