KEGG   Halopiger xanaduensis: Halxa_3950Help
Entry
Halxa_3950        CDS       T01532                                 

Definition
(GenBank) Cellulase
Organism
hxa  Halopiger xanaduensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3300054..3301136)
Genome map
AA seq 360 aa AA seqDB search
MESVPFDVDFLTELTETSGVPGYEDRVRDLVVEELEDTVDRVRTDAMGNVVGTLEGDGDS
DYSVAVAAHMDEIGFMVRHVRGGEDGPGFVELEALGGWDARVLKAQRVTIHTEDGDLPGV
IGSPPPHTLDEKEREKTPEVEDAFVDVGLPYEELEERVSPGDLVTMEQTTERMGETITGK
ALDDRICLFAMLEAARRLADGDGPEATIHFCATVQEEVGLRGAKALGVDVDPNLAIALDV
TVANDVPGFDDGEHVTDLGDGAAIKLKDGSVITSPKVHRRLKAVAEDEEIDYQLEILPAG
GTDTAGFQNVAGAKPVGAISIPTRYLHTVTETAHVDDVAATIDLLEAFLASEDGGHEYTL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttcccttcgacgtcgatttcctgaccgaactgaccgagacgagcggcgtc
cccggctacgaggaccgcgtccgcgatctcgtggtcgaagaactcgaggacaccgtcgac
cgcgtccgcaccgacgcgatgggcaacgtcgtcgggacgctcgagggcgacggcgattcg
gactactccgtggcggttgcggcacacatggacgaaatcggtttcatggtccgccacgtc
cgcggcggcgaggacggccccggcttcgtcgaactcgaggcgctcggcggctgggacgcc
cgcgtgctcaaagcccagcgcgtaacgatccacaccgaggacggcgatctgccgggcgtc
atcggctcgccgccgccccacacgttagacgagaaagaacgggagaagacgcccgaggtc
gaggacgccttcgtcgacgtcggcctcccctacgaagaactcgaggagcgggtctcgccc
ggcgacctcgtgacgatggagcagacgaccgagcgcatgggcgagacgatcaccggcaag
gcgctggacgaccggatctgcctgttcgcgatgctcgaggcggcccgccgactggccgac
ggcgacggacccgaggccacgatccacttctgtgcgacggtccaggaggaagtcggcctg
cgcggcgcgaaggcgctgggcgtcgacgtcgatccgaacctcgcgatcgcactggatgtc
accgtcgccaacgacgtgcccgggttcgacgacggcgagcacgtcaccgacctgggcgac
ggcgcggcgattaagctcaaggacggcagcgtcatcacgagtccgaaggttcaccgccgg
ctgaaggccgtcgccgaggacgaggagatcgactaccaactcgagatcctgccggccggc
ggcaccgacacggccggcttccagaacgtcgcgggcgcgaaacccgtcggcgcgatctcg
atcccgacgcggtacctccacaccgtcaccgaaaccgcccacgtcgacgacgtggcggcg
acgatcgacctgctcgaggcgttcctcgcgagcgaggacgggggtcacgagtacacgctg
taa

DBGET integrated database retrieval system