KEGG   Halopiger xanaduensis: Halxa_4014Help
Entry
Halxa_4014        CDS       T01532                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halxa_4014
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halxa_4014
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halxa_4014
Enzymes [BR:hxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halxa_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3366740..3367621)
Genome map
AA seq 293 aa AA seqDB search
MSDAATESETEYDSDVEAAIRENHPALITYITAGDPSLEDTKEYVEALDRGGSDLIELGL
PFSEPIAEGQTIQAAINRALEAGTTPEGFFELVDDLETEAPLLVMTYYNMILQYGDEPDV
RPFVERAADAGLSGIIVPDLPAEEADPLREACDDHGLDLVFIIAPTTEGQRLDDIMSQVS
GFAYVQARLGTTGARANVSTATHDSLARLSEYDVPKAVGFGVSEGDHAAEIVEAGADGVI
VGSTLVDIIASSDDTAEAVERLEAKAAELKRGARRGADSITVDAEDAPEPEQQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcagcaaccgagagcgagaccgagtacgacagcgacgtcgaggccgccatc
cgcgagaaccaccccgcgctgatcacctacatcaccgcgggcgacccgtccctcgaggac
accaaggagtacgtcgaggccctcgatcggggcggctccgacctgatcgaacttggcctc
ccgttctcggagccgatcgcggagggtcagacgatccaggccgcgatcaaccgcgcgctc
gaggccggcaccacgccggagggcttcttcgaactcgtggacgatctcgagacggaggcg
ccgctgctggtgatgacgtactacaacatgatcctccagtatggcgacgagcctgatgtc
cggccgttcgtcgagcgcgcggccgatgcggggctctcgggaatcatcgttcccgacctc
cccgccgaggaggccgacccgctgcgggaggcctgcgacgaccacgggctcgatctggtc
ttcatcatcgcgccgaccaccgagggccagcgcctcgacgacatcatgtcgcaggtctcg
ggcttcgcctacgtgcaggcccgcctcggcacgaccggggcgcgcgcaaacgtctcgacg
gcgactcacgacagcctcgcgcgcctctccgagtacgacgttcccaaggccgtcggcttc
ggcgtcagcgagggcgaccacgccgcggagatcgtcgaggccggcgccgacggcgttatc
gtcggcagcaccctagtcgatatcatcgcaagcagcgacgacaccgccgaggccgtcgag
cgcctcgaggccaaggcagccgaactcaagcggggcgcgcgccgcggcgccgactctatc
acggtcgatgcggaagatgcaccggaaccggaacagcaataa

DBGET integrated database retrieval system