KEGG   Halopiger xanaduensis: Halxa_4015Help
Entry
Halxa_4015        CDS       T01532                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halxa_4015
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halxa_4015
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halxa_4015
Enzymes [BR:hxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halxa_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3367618..3368886)
Genome map
AA seq 422 aa AA seqDB search
MSTHEHASETDDERRDGTFGDYGGQYVPEALMPALQELEDAYERYVLENEDGFMDEFRER
MRDFGGRPTPLQRADRLSERYGREIYLKREDLVHGGAHKLNNALGQVLLAKYMGKERVIA
ETGAGQHGTATAMAAAHLDMPCEIYMGRTDINRQRPNVYRMRMNGAEVNPVTAGSGTLKE
AINETMRDWATTVERTHYVIGSVVGPHPFPKLVRDFQSVIGKEARKQVQEKAGRLPDTVV
ACAGGGSNTMGAFHEFVPDEDVDLVAVEAGGSSLEIDEEEGLAPNSATLSTGTDGVLHGA
MTKLLQQSDGQIVESHSVSAGLDYAGVGPELSHLVESGRVTPTSVDDEAALNGFHRLSNL
EGIIPALESSHALGYLEEHTDELGDLVVVNVSGRGDKDLETVLEETGKRDLEAAPDVEVF
DA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacacgagcacgcgagcgagacggacgacgaacggcgggacggcaccttcggc
gactacggcggccagtacgtccccgaggcgctgatgccggccctgcaggaactcgaggac
gcctacgagcggtacgtcctcgagaacgaggacggcttcatggacgagttccgcgagcgg
atgcgcgacttcggcggccggccgacgccgctccagcgcgcggatcgactgagcgagcgc
tacggccgcgagatctacctcaagcgcgaggacctagtccacggcggcgcgcacaagctg
aacaacgcgctcgggcaggtcctgctggcgaagtacatgggcaaggagcgtgtcatcgcc
gagaccggcgccggccagcacggcacggcgaccgcgatggccgcggctcacctcgacatg
ccctgcgagatctacatggggcggacggatatcaaccgccagcggccgaacgtctaccgg
atgcggatgaacggcgccgaggtgaaccccgttaccgctggctccggcaccctgaaggag
gccatcaacgagacgatgcgcgactgggcgacgaccgtcgagcggacccactacgtcatc
ggctcggtcgtcggcccgcacccgttccccaaactcgtccgtgacttccagtcggtcatc
gggaaggaagcacgcaagcaggtgcaggaaaaagcgggtcggctccccgacaccgtcgtc
gcctgcgccggcggcggctcgaacacgatgggcgcgttccacgagttcgtcccggacgag
gacgtcgacctcgtcgccgtcgaggccggcggctcgagtctcgagatcgacgaagaggag
gggctcgcaccgaactcggcgacgctctcgacgggcaccgacggcgtgctccacggcgcg
atgacgaagctgctccagcagtccgacgggcagatcgtcgagtcccacagcgtcagcgcg
ggactggactacgccggcgtcgggccggagctctcgcacctcgtcgaaagcggccgcgtg
acgccgaccagcgtggacgacgaggccgcgctcaacggcttccaccggctctcgaacctc
gaggggatcattccggcgctggaatcgagccacgcccttggctatctcgaggagcacacc
gacgaactcggcgatctcgtcgtcgtcaacgtctccggccgcggcgacaaagatctggaa
acggtgctcgaggaaaccgggaaacgcgatctcgaggcggcccccgatgtggaggtgttc
gatgcatga

DBGET integrated database retrieval system