KEGG   Halopiger xanaduensis: Halxa_4016Help
Entry
Halxa_4016        CDS       T01532                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01130  Biosynthesis of antibiotics
hxa01230  Biosynthesis of amino acids
Module
hxa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halxa_4016
Enzymes [BR:hxa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Halxa_4016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE FMN_dh His_biosynth ThiG Trp_syntA PDZ
Motif
Other DBs
NCBI-ProteinID: AEH38621
JGI: Halxa_4016
UniProt: F8DB73
Position
complement(3368893..3369696)
Genome map
AA seq 267 aa AA seqDB search
MNSETELAPAVASILEAARERPGGESAVDVDARSLPDAIASAEADGRVPVIAEVKPTSPT
ADGTRDDDPVELAEAMVEGGASAISVLTEPSHFGGSPEALTRVREAVDVPVLRKDFVLEE
AQLDVVEADLLLLIARFVDDLEGLVAAARERGFQPLVEVHDREELEAALEAGAEIIGVNN
RDLAQLEVDLETFESVSPHAPDDVTLIAESGVSSPADVRRMRETGADALLVGSAIMDHGA
GDSDVAANTRRLTEAEATAETSDDNGD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgaaacggagctcgcgcccgcggtagcgtcgatcctcgaggccgcccgggag
cgccccggcggcgagagcgccgtcgacgtggacgcgcggtcgctgcccgacgcgatcgcg
agcgcggaggcggacggccgcgtgccggtgatcgcggaggtcaaaccgacgagtccgacg
gccgacgggacgcgcgacgacgatcccgtagaactggctgaagcgatggtcgagggtggc
gcgtcggcgatctccgtgctgaccgaaccctcccacttcggcggctcgcccgaggcgctg
acccgcgtccgcgaggccgtcgacgtccccgtcctccggaaggacttcgtcctcgaggag
gcccagctggacgtcgtcgaagcagacctcctgctgctgatcgcccgcttcgtggacgac
ctcgaggggctcgtcgcggccgctcgcgagcgggggttccagccactcgtggaggtccac
gaccgcgaagaactcgaggccgcgctcgaggcgggcgcggagatcatcggggtcaacaac
cgggatctggcgcaactcgaagtcgacctcgaaaccttcgagtccgtgagtccccacgct
ccggacgacgtgactctcattgcggaaagcggcgtctcgagtccggcggacgtgcgccgg
atgcgcgagacgggcgcggacgccctcctggtcggcagcgccatcatggaccacggcgcg
ggcgacagcgacgtcgccgcgaacacgcggcggctgacggaggcggaagcgacagcggag
acgagcgacgacaacggagactga

DBGET integrated database retrieval system