KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0005Help
Entry
HY04AAS1_0005     CDS       T00745                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HY04AAS1_0005
Enzymes [BR:hya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HY04AAS1_0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4258..5445
Genome map
AA seq 395 aa AA seqDB search
MKITFLNTSKDVHVYIKRNIHYSIKTEDVSKIVPSFAIKFEGFLEKNVLENAARFGVFCH
NQGKYAFVIGNKFGIFELLKATKPKIAKELIKHIINFGKEHRYNISYNTKVLHLSDMKPL
VMGVINITKDSFYAPSRVDEKDILFRVEEFIKEGADIIDIGAQSTRPGAEEISSEEEVRK
LLEPLRKIRKEFKNVWISIDTYFSNTARVCLEEGADIINDISGGVFDDDILKTIAVYNCP
YIIGHSSSYKPNQWPHTDFEYEDITLEIINHFKSQETKLLELGYNLFNGIIIDPCIGFAK
KPMHNLEILNQIEALRSLDRPILIGTSRKSFIGIVIKEFLQKESIPAPEQRLVGSLGSIA
QSITKNACHIVRTHDVATTKEFIALLDAIRNYHYA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacatttttaaatacgtcaaaagacgtccatgtatatataaaaagaaatatc
cattacagtattaaaaccgaagacgtatctaaaatagtgccctcttttgctataaagttt
gagggctttttagagaaaaacgtgctagaaaatgctgctcgttttggtgtattttgccac
aatcaggggaaatatgcatttgttataggaaataagtttggtatttttgagcttttaaaa
gccacaaaaccaaaaatagctaaagaacttataaagcatattattaattttggcaaagag
caccgttacaacatatcttacaacacaaaagttttgcacctttcagacatgaaaccactt
gtaatgggagttataaatataaccaaagattccttttacgcaccttcaagggtggatgag
aaagatatactttttagagtagaagagtttataaaagagggtgcagatataatagatata
ggagctcaatctactagacctggagcagaggaaatatcttctgaggaagaggttcgtaag
cttttagaacccttaagaaagataagaaaagagtttaagaatgtgtggatatccatagat
acatatttttccaatactgctagggtatgtcttgaagaaggggcagatattataaacgat
ataagtggtggagtttttgacgatgatatactaaaaactatagctgtttataactgccct
tacatcataggacattcctcttcgtacaaaccaaatcagtggccccatacagattttgag
tatgaggatataacccttgaaattataaatcattttaaaagccaagagacaaagctttta
gaacttgggtataatctctttaacggcataatcatagacccatgtataggctttgccaaa
aaacctatgcacaacttagaaattttaaatcagatagaagctcttagaagtcttgatagg
ccaattcttataggtacttcaagaaaatcttttataggtatagtgataaaagagttttta
caaaaagaatctataccagccccagagcaaaggcttgtaggaagtcttgggtctatagcc
caaagtattacaaaaaacgcttgccatattgtaagaacccatgatgtagctactactaaa
gagtttatagcgcttttagatgcaataaggaattatcattatgcttga

DBGET integrated database retrieval system