KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0018Help
Entry
HY04AAS1_0018     CDS       T00745                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HY04AAS1_0018 (folE)
Enzymes [BR:hya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HY04AAS1_0018 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(18238..18786)
Genome map
AA seq 182 aa AA seqDB search
MIDKEKIIEGIKLFLEGIGEDITREGIKETPERVAKMWEEFEKERSFDFKLFEEYSNYSE
MIIVKDIPFYSMCEHHLLPFFGKAHIAYIPNKKICGLSKLVRTVRAMALKPQVQERLTEE
IADIVQKELEPMGVGVVIEAEHLCMSMRGVRSPGHCTVTSSLRGNFLSDIRTKEEFFKLI
RQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaaagagaagattatagaaggtataaaactcttcttagaaggtataggagaa
gatatcacaagagaaggcataaaagaaactccagaaagagtcgctaagatgtgggaggaa
tttgaaaaagagaggtcctttgattttaagctttttgaagagtacagcaactattctgaa
atgattatagtaaaggatatacctttttatagcatgtgtgagcatcatcttttaccgttt
tttggcaaagctcacatagcatatataccaaacaaaaagatatgtgggctatctaaactt
gtaagaacggtaagggctatggctttaaaaccacaagtccaagaaaggcttacagaggaa
atagccgatatagtccaaaaagaattagaaccaatgggagttggtgtcgtaatagaggca
gagcatctttgcatgtctatgagaggagtaagatcaccaggacattgcaccgtcacttcc
tctttaaggggaaactttttaagcgatattagaacaaaggaggagttttttaaactcata
agacaatga

DBGET integrated database retrieval system