KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0040Help
Entry
HY04AAS1_0040     CDS       T00745                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hya01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hya00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hya00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hya00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hya00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hya00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:hya00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:hya00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:hya00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(35611..36291)
Genome map
AA seq 226 aa AA seqDB search
MKRYNMRIAGVGGQGVVTSAHILGNAMSAAGKYASLVPFFGSEKRMAPVEAYVRASDQPI
YEVGEVVYPNVIMIYHPQVITHGKSYTMPFYSGLKPDGLVIINTDVDIIPEEDHAILEKL
NTKVINFPATKIALDIAGTELATNMAMIGLFFGITRLVDFEYIEQAVKERFLGNTFVASG
GTASLDSAIEKKFKKKVELLEKNMQVIKEAFRMAEENGWILEEITV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggtacaacatgcgtatagctggtgttggtggtcaaggggttgtgacctctgct
cacattctaggtaacgctatgtcggctgccggcaaatatgcctctttagtaccgtttttt
ggttctgagaaacgtatggcaccggtggaggcttacgttagagcttccgatcaacccata
tacgaagtgggtgaagtggtttatccaaacgtaataatgatttaccatccacaagttata
acacacggtaagtcttatacgatgcccttttactctggtctaaaacccgatggacttgtt
attataaacaccgatgtagatataataccagaagaagatcacgctatattggaaaagctc
aatacaaaagtaataaactttccagccacaaagatagcccttgatatagcaggaacagag
cttgccacaaatatggctatgattggtcttttctttgggataacaagacttgtagacttt
gaatatatagagcaagctgtaaaagaaaggttcttgggtaatacgtttgtagcttccggt
ggtacagcttctttggacagcgccatagaaaagaagttcaagaagaaggtagaactcttg
gaaaagaatatgcaagttataaaagaagcttttagaatggctgaagagaatggatggata
ttggaagaaatcactgtttaa

DBGET integrated database retrieval system