KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0042Help
Entry
HY04AAS1_0042     CDS       T00745                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HY04AAS1_0042
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_0042
   00020 Citrate cycle (TCA cycle)
    HY04AAS1_0042
   00620 Pyruvate metabolism
    HY04AAS1_0042
   00640 Propanoate metabolism
    HY04AAS1_0042
   00650 Butanoate metabolism
    HY04AAS1_0042
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_0042
   00680 Methane metabolism
    HY04AAS1_0042
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HY04AAS1_0042
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HY04AAS1_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(37200..38369)
Genome map
AA seq 389 aa AA seqDB search
MPEQKVVDTDYLLLEAPREKKFITGSQAMAEAVKRANVDIAIAYPITPQSETMHLVGDLW
AQGYVKDYYRAEEEYGTMSAIAGAVRGGVRAFTATSGPGLLRGIEAIASWPGHRIPAVLG
VLTRVVNAPLSIQPDNVEISYLLNCGMVVLHAENQQDVFDFTLASFAISEMVDVYLPIAV
CTEGFFVTHAKGYVNMTPEDMKLPPRDPYKAPVPPTDCEIPPARIQRDAPVQKSNFMSYL
IHQVWQQEVWSSNMRAMKYMYKYINGPIEVINPEAEVFVAASGCAAAQAREAVRYAQMEG
LNVGLLKIKSIVPFPSKEVRETLKNAKAVIVPEHNIVGWLSKEIKANIQDSDKVIGKPRV
YGGMTLPVELIMDEIYAALGIKKDKTVLV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacaaaaagttgttgacacagattatcttctcttggaagctccaagagagaag
aaatttataactggctcacaagccatggctgaagctgtaaaaagagccaacgtagatata
gctatagcttatccaataaccccacaatcagaaaccatgcacctggtgggcgatttatgg
gctcaaggttatgtaaaagattattatagagccgaagaagagtacggaactatgtcggcc
atagcaggtgcagtaagaggcggagttagagctttcacggctacatctggacctggtctt
ttaaggggtatagaggcgatagcctcatggccaggacacagaataccggcagtcttaggt
gttctaacaagggttgtaaacgctcctctttctatacaaccagacaacgtagagatatca
tatcttctaaactgtggaatggttgtattacacgctgaaaaccagcaagatgtttttgac
ttcacactcgcatcttttgctatatcagaaatggtagatgtatatttaccgatagccgta
tgtacagaaggtttcttcgtaactcatgctaaaggctatgtaaatatgacaccggaagat
atgaagcttccaccaagagatccatacaaagctccggttcccccaacagattgtgaaata
ccacccgcaagaatacaaagagacgctcccgttcaaaagtctaactttatgagctaccta
atacaccaagtatggcaacaagaagtatggtcttccaacatgagagccatgaaatacatg
tataaatatataaacggtcctatagaagttataaacccagaggctgaagtatttgtagca
gcttcagggtgcgcagcagctcaagccagagaggctgtaagatacgcccaaatggaaggc
ttaaacgttgggcttttaaagataaaatccatagtcccgttcccatccaaagaagtaagg
gaaactttgaaaaatgcaaaagctgtcatagtaccagagcacaacatagtaggatggtta
tctaaagagataaaggcaaatatccaagatagcgacaaagtcataggaaaacctagagtt
tatggaggtatgacacttccagtagaacttataatggatgaaatatatgccgctcttggt
attaaaaaggacaagacggtgcttgtttaa

DBGET integrated database retrieval system