KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0095Help
Entry
HY04AAS1_0095     CDS       T00745                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HY04AAS1_0095
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HY04AAS1_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
87770..88906
Genome map
AA seq 378 aa AA seqDB search
MTRLGVLGSTGTIGKNALDIVRSNKDKIELIGIGAYRSSKGLLEEVKEFRPKFVFSVETP
TKDWIDEVSKYSTYLNEEEGLQAIIENSDRILNAISGTSGIKATYSILKAKKILLASNKE
SILCMPNLIRENIELVIPVDSEHNAAFELLKSHKTVKNLYITASGGPFRGYSKEQLKTVS
KEEALKHPNWKMGPKITIDSATLMNKGFELVEASVLFNIPLERIKILIHPQSIVHAIVEL
ENGSFIANMSLPDMRLPIQNAIFYPEMVNYTFNRLDLTSISCLTFEKPKRDLFRAIDVCE
WVASMGNPYVSVLLGADDKAVELFLEGKIGFLDIPVLIESVLSSVNFHIEENLEDILRAV
EFGKNKLLELSNHRLTNC
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcttggtgtacttggttctacggggactattgggaaaaatgcccttgatatt
gttagatcaaacaaagataagatagagcttataggtataggtgcatatcgatcatccaaa
gggcttttagaagaggttaaagagtttagacctaagtttgtttttagtgtagaaacccct
acaaaagactggattgatgaggtttcaaaatattctacataccttaacgaagaagaggga
cttcaggctattatagaaaactccgataggattttaaacgctatatctgggacctctggc
ataaaagccacttacagcatactaaaagctaaaaaaatacttcttgcttccaacaaggaa
tcaatcctttgtatgccaaacctaataagagaaaatattgagctagtgataccggtagac
agcgaacacaatgccgcttttgagcttcttaaaagccacaaaactgtgaaaaacctttat
ataacagcttcaggtggtcctttcagagggtattccaaagaacagctaaaaactgtaagc
aaagaagaggctcttaaacacccaaattggaagatgggtccaaagataaccatagactct
gcaacacttatgaacaaaggatttgaacttgtagaagccagtgtattgtttaatatacca
cttgaacgcataaagatattgatacatcctcaaagtatagtgcatgccatagttgaactt
gaaaacggctcttttatagcaaatatgtcgcttccagatatgaggcttcctattcaaaac
gctattttttatccagagatggtaaattataccttcaataggttagatttaacatctatt
tcttgtcttacttttgaaaagcctaaaagggatttgtttagggctatcgatgtttgtgaa
tgggtagcctctatgggaaacccttatgtatctgtgcttttaggagctgatgataaagct
gtagagctttttttagaagggaaaattggatttcttgatataccagttttgatagagagc
gtactttcttcggtgaattttcatatagaagagaatcttgaagatattttaagggctgtg
gagtttggtaaaaacaaattactagaattatcaaatcataggctaactaactgttaa

DBGET integrated database retrieval system