KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0113Help
Entry
HY04AAS1_0113     CDS       T00745                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HY04AAS1_0113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HY04AAS1_0113
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HY04AAS1_0113
Enzymes [BR:hya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HY04AAS1_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
104394..105593
Genome map
AA seq 399 aa AA seqDB search
MYSQPDEKGYFKEGDIAFGGRFLPETLMYALEELEYFYKKLKDDEFFKNQLNYYLKDYAG
RPTPLYFAQKLSELAGAKIYLKREDLLHTGAHKINNAIGQCLLAKKMDKHRIIAETGAGQ
HGVATATACALLGLECVVYMGEEDVRRQRLNVFRMELLGAKVEVVTSGTKTLKDAINEAL
RDWVTNVETTHYVVGSVVGPHPFPMIVRDFQKVIGEETRSQIIEKEGRLPNFVIACVGGG
SNSIGIFYPFIDDKEVKLIGVEAGGLGLASKKHAAPLSDGEVGILHGMKSYFMQDEEGQI
LGTHSVSAGLDYPGVGPEHAFLKATKRATYIYATDEEALEGFKLLAKTEGIIPALESSHA
VIKAIDIAKENPGSLMIINLSGRGDKDVNQIFDMFKGGI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtcaaccggacgaaaaaggttattttaaagaaggagatatagcttttggtgga
aggtttttgcctgaaacattgatgtatgctcttgaagagcttgaatatttttataaaaaa
ctcaaagacgacgaattttttaaaaatcaactaaattattatctgaaagattacgctgga
aggccaacccctctttattttgcccaaaagctttctgagcttgccggtgctaagatatat
ctcaaaagagaagatttgcttcatacaggggcgcacaagataaacaacgccataggacaa
tgccttttggccaaaaaaatggataaacaccgtatcatagctgagacaggtgcaggacaa
catggtgtggctacggctaccgcttgtgcgttgcttggtcttgaatgcgtggtttatatg
ggtgaagaagacgttaggcgtcagaggttaaatgtttttagaatggagcttttaggtgca
aaggtggaagtggtaacctctggtacaaaaacattaaaagatgccatcaatgaagcgttg
agagattgggttacaaacgttgaaactactcattatgtagttggttctgtggtgggcccc
catccttttcctatgatagtgagagattttcaaaaagtaataggagaagagacaaggtct
caaataatagaaaaagagggaagacttcctaattttgttatagcttgtgtaggtggtggt
tcgaactccataggtattttttacccttttatagatgataaagaggttaagcttataggt
gttgaagcaggtgggcttggtcttgccagtaaaaaacatgcggcacctttatcggatggt
gaagtgggaatacttcatggcatgaaatcttactttatgcaggatgaagaaggtcaaata
ttgggtactcattctgtatctgctggtcttgattatcctggtgtgggtccggagcatgct
ttcttaaaagctacaaaaagagctacatacatatatgctactgacgaagaggcgctggag
ggttttaagcttttagcaaaaacagaaggtataatacctgctttggaatcttctcatgct
gttataaaggctatagatattgccaaagaaaaccccggttctttaatgataataaacctc
tccggtagaggcgataaggatgtaaatcagatatttgatatgtttaaaggtggtatttag

DBGET integrated database retrieval system