KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0244Help
Entry
HY04AAS1_0244     CDS       T00745                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HY04AAS1_0244
DNA repair and recombination proteins [BR:hya03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HY04AAS1_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217272..217943
Genome map
AA seq 223 aa AA seqDB search
MAFEDFIPRNLLKALENIKHIPGYGEKNASRFVYGFLKLDKIKKEDIVKSLENLFSITTC
KECNILTDQEVCAICSNPKRSKKYIAVVEESQDAYKIEKLERFKGVYHILGGRISPLEGI
APEDLSIELLKERIRKYNPKEIIIATNPNPEGEATANYLIKIIKSLNNKSATSMPRTTSM
PRTTSLPRSTTPKITRIATAIQFGTLIEYVDDLSLEESIEKRE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggcctttgaggattttataccaagaaatcttctaaaagctttggaaaacataaaacat
atacctggctatggtgaaaaaaacgcttcaaggtttgtatacggctttttaaagcttgat
aaaatcaaaaaagaagatatcgtaaaaagcttagaaaatcttttttctataactacatgt
aaagagtgcaacatacttacagatcaagaagtttgtgctatatgctctaatccaaaaaga
agtaaaaagtatatagctgtagtagaagagtctcaagatgcttacaagatagaaaaattg
gagcgttttaaaggtgtttatcatattttaggtggtcgtataagtccactggagggtata
gcaccagaagatttgagtatagagcttttaaaagaaagaataagaaaatacaatccgaag
gagataataatagccacaaatccaaacccggagggtgaggctacagctaactatcttata
aaaataataaaaagcttaaacaataaatctgctacaagtatgccacgcaccacaagtatg
ccacgcaccacaagtctaccacggtctactacaccgaagataacacgcatagccaccgct
atccagtttggtacgcttatagagtatgtggacgatctatctttggaagagagcatagaa
aaaagggaatag

DBGET integrated database retrieval system