KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0244Help
Entry
HY04AAS1_0244     CDS       T00745                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hya03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217272..217943
Genome map
AA seq 223 aa AA seqDB search
MAFEDFIPRNLLKALENIKHIPGYGEKNASRFVYGFLKLDKIKKEDIVKSLENLFSITTC
KECNILTDQEVCAICSNPKRSKKYIAVVEESQDAYKIEKLERFKGVYHILGGRISPLEGI
APEDLSIELLKERIRKYNPKEIIIATNPNPEGEATANYLIKIIKSLNNKSATSMPRTTSM
PRTTSLPRSTTPKITRIATAIQFGTLIEYVDDLSLEESIEKRE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggcctttgaggattttataccaagaaatcttctaaaagctttggaaaacataaaacat
atacctggctatggtgaaaaaaacgcttcaaggtttgtatacggctttttaaagcttgat
aaaatcaaaaaagaagatatcgtaaaaagcttagaaaatcttttttctataactacatgt
aaagagtgcaacatacttacagatcaagaagtttgtgctatatgctctaatccaaaaaga
agtaaaaagtatatagctgtagtagaagagtctcaagatgcttacaagatagaaaaattg
gagcgttttaaaggtgtttatcatattttaggtggtcgtataagtccactggagggtata
gcaccagaagatttgagtatagagcttttaaaagaaagaataagaaaatacaatccgaag
gagataataatagccacaaatccaaacccggagggtgaggctacagctaactatcttata
aaaataataaaaagcttaaacaataaatctgctacaagtatgccacgcaccacaagtatg
ccacgcaccacaagtctaccacggtctactacaccgaagataacacgcatagccaccgct
atccagtttggtacgcttatagagtatgtggacgatctatctttggaagagagcatagaa
aaaagggaatag

DBGET integrated database retrieval system