KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0321Help
Entry
HY04AAS1_0321     CDS       T00745                                 

Definition
aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hya00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hya00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
280180..281046
Genome map
AA seq 288 aa AA seqDB search
MKYIIEAQNIKDTYKTILNRAKEFKEKRIYPTYKASCALFFEEPSTRTRLSFEKAAKNLG
CETYYIQGNFSSAVKGESFFDTLLSFKKIDIDIVVFRTSDIVFDYEPLLNIDIGLINAGD
GTHEHPSQGLLDVFTLLEKVNSLENQNILYVGDVYHSRVFRSGAYFFKLEGANIGVCGYP
SFIPKDYPFMDKAFTNLDEAIDWAHHVIALRIQKERHKEAYNLESYFDMYGITKERYNKI
RGFLMHPGPVNRDVDIDGDLLYKDKSLIANQIENGVFVRMAMIEYVLG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatataatagaagcccaaaacataaaagatacatacaaaactatattaaatagg
gctaaagagtttaaggaaaaaaggatatatcccacttacaaagcatcttgtgctcttttt
tttgaagaaccatccacaagaacaaggctttcttttgaaaaagccgccaagaatttgggt
tgtgagacttattatatacaaggtaatttttcatcggctgtaaagggtgaaagttttttt
gatacgcttttatcttttaaaaagattgacatagatatcgttgtttttcgtacatctgat
atcgtatttgattatgagccacttctaaatatagatataggccttataaatgctggagat
ggtacgcacgagcatccgtctcagggtcttcttgatgtttttacgcttttagaaaaagta
aatagtttggaaaatcaaaatatactatacgtaggagatgtttaccacagtagagtgttt
aggtcaggagcttactttttcaagttagaaggggcaaatataggtgtttgtggatatcca
agctttataccaaaagattatccttttatggacaaagcttttacaaatttggatgaggcg
attgattgggctcatcatgtgatagctctacgcattcaaaaagaaagacacaaagaagct
tacaatttagaaagttattttgacatgtatggtataacaaaagaaaggtataataagata
agaggatttttgatgcatcctggccctgtaaatagggatgttgatatagatggtgatttg
ttgtataaagataaatctttgatagcaaatcagatagaaaacggcgtgtttgtccgtatg
gctatgatagaatatgttttaggatag

DBGET integrated database retrieval system