KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0324Help
Entry
HY04AAS1_0324     CDS       T00745                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HY04AAS1_0324
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HY04AAS1_0324
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HY04AAS1_0324
Enzymes [BR:hya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HY04AAS1_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
282548..283606
Genome map
AA seq 352 aa AA seqDB search
MGYWKGLIHAYREYLPVSEKTPIITLYEGNTPLIKAQRIPDMLKVGVELYFKFEGLNPTG
SFKDRGMTMAISKAAESGKRAVICASTGNTSASAAAYAARAGMKAFVVLPKGAVALGKLS
QAIIYGAKVIALLGNFDDALFIVRKIGEILPVEVVNSVNPYRIEGQKTAAFEIVDALGDA
PTYHFIPVGNAGNITAYWKGYKEYHAIGKSKKLPIMMGYQAEGSAPIVKGYPIKNPQTIA
TAIKIGNPYSWRNAIQAAKESNGKIDAVTDDEILYAYNLVASCEGVFCEPASAASVAGFI
KSAKEGIFKEGDVVVCTLTGSGLKDPDTAMKSAQSPIEVPPDLNQVLKLIEI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggatattggaaaggactaatacacgcatatagagaatatttgccggtttctgaaaag
acacctattataaccctttacgaaggcaacacgcctcttataaaagctcaaagaatacca
gacatgctaaaagtaggggtggagctttattttaagtttgaaggcctaaaccccacaggt
tcttttaaggatagaggcatgacaatggctatatcaaaagccgccgaatctggtaaaaga
gccgttatatgtgcatccactggcaatacctcagcttcggctgctgcttacgctgcaaga
gctggtatgaaagcttttgtggtacttccaaaaggtgctgtagctcttggtaaactatcc
caagctatcatatacggtgccaaggtaatagcgcttcttggaaattttgatgatgctttg
tttatagtaagaaaaataggtgagatattaccagtagaagtggtaaattctgtaaaccct
tatcgtatagaaggtcaaaaaaccgctgcctttgaaatagtagatgctttaggggatgct
cccacttatcattttatacctgttggaaacgctggtaacataacagcctattggaaaggt
tataaagagtatcatgctataggaaaatcaaaaaaacttcccattatgatgggttatcag
gcagaaggatcggctcctatagtaaaaggttatcctataaaaaaccctcaaaccatagcc
accgctataaaaataggcaatccttacagctggagaaatgccatccaagccgccaaagaa
tcaaacggtaaaattgatgcggttaccgatgatgagatactttacgcttacaaccttgtg
gcttcttgtgaaggggttttttgtgaaccagcttccgctgcatctgtggcaggctttatt
aaaagcgccaaagaaggtatttttaaagaaggcgatgtggtagtctgcacattgacgggt
tctggcttaaaagacccagataccgctatgaaatccgcccaaagccctatagaagtacct
ccagatttaaaccaggttttgaagcttatagagatttaa

DBGET integrated database retrieval system