KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0339Help
Entry
HY04AAS1_0339     CDS       T00745                                 

Definition
Hydroxylamine reductase (EC:1.7.99.1)
Orthology
K15864  
nitrite reductase (NO-forming) / hydroxylamine reductase [EC:1.7.2.1 1.7.99.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    HY04AAS1_0339
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.1  nitrite reductase (NO-forming)
     HY04AAS1_0339
   1.7.99  With other acceptors
    1.7.99.1  hydroxylamine reductase
     HY04AAS1_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297010..298656
Genome map
AA seq 548 aa AA seqDB search
MVKKFLLLGTVFGAFMFVGKEAVSQDSVPNSAKQDTQPLTKQEYEMAKQIYFNRCAGCHG
ELRTGAIGPALTPDKMKQLGIQNIETFITYGSPKGMPDWGKSGVLTPEQISVMARFLQLP
PPSPPEFDLPDIEKTWQLIVPVNQRPKTPLTNKDISNYMGVVLRSANEAAIIDDATKKPV
AILKTGHALHILRADASGEYFYSIGRDGKVSLIDLYYKHPKIVAQIKACYDARSVEVSLY
HGKEGDYRDKYAIVGCYWPPQFVILDGSTLKPLKVVSTVGYQVGTGKFIRDPRVAAIVAS
YFHPEWIVNVKETGQIWIVNYKDLKNLKITMVDAAPFLHDGGWNSTKRYFLAAANASNKI
AVLDAKKDKLAKLIDTPKLPHPGRGANIYNPKYGPLYCSSFIGQGVVACIGTDPKHHPQY
AWKVVKIIKLPGEGGGSLFIKTNPHVHYMFVDRTLNPDQKLQRQFYAIDTRTLKVVHTFN
MPKDLKGRFVDFDFNKQGTELWVSDWDKEGAILIYNPNTFKLEDVIKGKWVISPTGKFNV
YNTVHDIY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagtttctcctcttaggtaccgttttcggggctttcatgttcgttggtaag
gaggctgtatcacaagattcggttccaaattccgcaaagcaggatacacagcctcttacg
aagcaagagtacgagatggcaaaacaaatctatttcaataggtgtgccggttgccacggt
gaacttagaactggtgcaataggacccgctcttacaccagacaaaatgaaacagcttggt
attcaaaacatagaaacatttattacgtatgggtctccaaaaggcatgccagactgggga
aaatctggtgttcttacaccggaacaaataagtgtaatggcgaggtttttacagcttcct
ccaccaagtcccccagaatttgatcttccagatatagaaaaaacatggcaactcatagtg
ccagtaaaccaaagaccaaaaactccgttaaccaataaagatatatcaaattatatgggt
gtcgtgctccgttcggcgaatgaagccgctataattgatgatgccaccaaaaaaccagta
gccatattaaaaaccggacatgctttacacatactaagggctgatgcttctggagaatac
ttttactctataggaagagatggcaaggtcagtctaatagacctttactataaacaccca
aagatagtagctcagataaaagcctgctacgatgccagatctgtagaggttagtctttac
catggtaaagagggtgattatagggataaatatgctatagtaggatgctattggccacct
caatttgtcatccttgatggatctactttgaaaccgctcaaggttgtatctaccgtaggc
tatcaagtaggtacaggaaagtttataagggatccaagggttgcagctatagtagcttct
tactttcatcctgaatggatagtaaacgtaaaagaaactggccagatatggatagtgaat
tataaagatctcaaaaatctcaagattactatggttgatgccgcaccgttcttacacgat
gggggatggaactcaacaaaacgatacttcttagccgccgccaacgccagcaataaaata
gctgtgcttgatgctaaaaaagataaattagctaaattgatagatactccaaaacttcct
catcctggtagaggtgccaacatatacaatcctaagtacggtcctctttattgttcttct
tttatcggacaaggcgtagtagcatgtataggcaccgatccaaagcatcaccctcagtat
gcatggaaagtagtaaagataataaaactacctggagaaggtggtggttctttgtttatc
aagacgaacccacacgtgcattatatgtttgtggatagaactctaaatccagatcaaaaa
cttcaaagacaattttacgctatagatacaagaacccttaaggtcgtccatacgttcaac
atgcctaaggatctcaaaggaagatttgtggattttgattttaacaaacaaggcaccgaa
ttgtgggtttctgactgggataaagaaggggctatactgatatacaatccaaacacattc
aaattagaagatgtgataaaaggcaaatgggtaatatcccccacaggtaagttcaacgtt
tataacaccgtacacgacatctactaa

DBGET integrated database retrieval system