KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0394Help
Entry
HY04AAS1_0394     CDS       T00745                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hya00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HY04AAS1_0394
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HY04AAS1_0394
Enzymes [BR:hya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HY04AAS1_0394
Two-component system [BR:hya02022]
 CheA family
  CheA-CheYBV
   HY04AAS1_0394
Bacterial motility proteins [BR:hya02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HY04AAS1_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(346405..347463)
Genome map
AA seq 352 aa AA seqDB search
MANILIVDDSFFIRAAIRKILESSNLVENIYEASNGIEALEILKNQNIDLVTLDVEMPKM
NGLETLERIKKENISTQIIMVSAYTTQGAKETIKALELGALDFIAKPKNYADFYKVKDEL
LRKIENAILKKKSIADKLKALKEEKKIETPPPQIPSPPIRKLGSKGVVAIGISTGGPQTL
GEILPKLPSDYPYPITIAIHMPDTFTKSFAEHLNSKCKLNVKEAEENEVLKPGTVYISRG
RINMKITGNDSMPIVNYVKDDSIIYIPSANSLLSSCAKVFKENTCGIVMTGMGDDGSRGI
VDVKKNGGITVAEDPKTAILWAMPENAIKTGCVDFVLKKDEIPNFLLKIAKQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatacttatagtagacgattcgttttttataagggcggcgataaggaaaata
ttggagtcttcaaatcttgtagaaaacatctatgaagctagtaatggcatagaagcttta
gagattttaaaaaatcaaaacatagaccttgtgactttagatgtagaaatgccaaaaatg
aacggtttggaaaccttagaaagaataaaaaaagaaaatatatcaactcaaataataatg
gtaagcgcttacactacccaaggagcgaaggaaactataaaagctctagaacttggagct
ttagattttatagcaaagccaaaaaattacgcagatttttacaaggtaaaagatgagctt
ttaagaaaaatagaaaatgcaattttaaagaaaaaaagcatagcagataagttgaaagct
ctaaaagaagaaaaaaagatagaaacaccgccgccccagataccaagtccacctataaga
aaattgggaagcaaaggtgtggtagcaataggtatatctacaggcggcccacaaacactt
ggggaaatattgccaaaattgccttcagactatccttatccgataactatagcaatacat
atgcctgatacgtttacaaaaagtttcgcagagcatctaaattcaaagtgtaaactaaac
gttaaagaagcagaagaaaatgaagtattaaaaccaggcaccgtatatatatcaaggggt
aggataaatatgaaaatcactggaaacgatagtatgcctatagtaaactacgtaaaagat
gattctataatatatataccatctgccaattcacttttgtcttcttgtgccaaggttttt
aaggaaaacacctgcggtatagtaatgaccggcatgggcgacgacggatctaggggtata
gtagatgttaagaaaaatggcggtatcacggtagcggaagatccaaaaacagctatacta
tgggctatgccagaaaatgcgataaaaaccggttgtgtagattttgtgcttaaaaaagat
gagattccaaattttcttcttaaaatagcaaaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system