KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0460Help
Entry
HY04AAS1_0460     CDS       T00745                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00330  Arginine and proline metabolism
hya00332  Carbapenem biosynthesis
hya01100  Metabolic pathways
hya01130  Biosynthesis of antibiotics
hya01230  Biosynthesis of amino acids
Module
hya_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HY04AAS1_0460
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HY04AAS1_0460
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HY04AAS1_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACG57150
JGI: HY04AAS10460
UniProt: B4U7N9
Position
complement(400021..401052)
Genome map
AA seq 343 aa AA seqDB search
MIFVIKIGSNVLSTEGGDFDISFISSIAEDIKTLQKEHIKFLIVSSGAVMAGKKILNIKG
DSILSRQILASVGQSRLMSLYDNIFSNYNLTISQILITSDIFTNQNMFSNAQRTIEGLLD
HNIIPIINENDAIATEELIFGDNDFLSVYVSYISKASKLVIFSTAGGLYTKDGKTLIKEV
SNFEEAFKEVNPSKSTFGSGGMLSKLQASMMASNIGIEVFITSKSQRLIDIYTDKAIGTK
IPPKQNSKLKPKDLIKLAQYSRGIIYIDEGAKKALLSRKALLAIGIKGFDGVFKKGDLVS
ISDEQGIMIGKGKVQYDSKELKNIIGKKNKEVIKTDDIYIIHI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgttatcaaaattggttcaaacgtcttatctacagagggaggggattttgac
ataagctttatctcctccatcgccgaggatataaaaactctacaaaaagaacatattaag
tttcttatagtatcctccggagccgttatggctggaaaaaaaatcctaaatataaaaggg
gattccatcctttcaagacaaatacttgcctccgttggccaatcgaggcttatgtctttg
tacgacaacatattttcaaattataaccttactataagccaaatacttataacctctgat
atttttacaaatcaaaacatgttttcaaacgcccagaggacgatagaaggactcttagat
cacaacatcatacccattataaacgaaaacgacgctatagccaccgaagagcttatattt
ggagataacgattttttaagcgtttacgtatcttatatatcaaaagcctcaaaacttgtt
atattctcaactgccggcgggctttatacaaaagatggcaaaaccctcataaaagaagtg
tcaaattttgaagaggctttcaaagaggtaaacccctccaaaagcacctttggaagcggt
ggcatgcttagcaaactacaagcttccatgatggcatcaaacatcggtatagaggttttt
ataacctctaaaagccaaagacttatagatatatacactgacaaagctataggcaccaaa
ataccaccaaaacaaaactcaaaactaaaaccaaaagatcttatcaaattggcccagtat
tcaagaggcatcatatatatagatgaaggggctaaaaaagcacttttaagcagaaaagca
ctccttgccataggtataaaaggttttgacggagttttcaaaaaaggggatctggtaagt
atatcagatgaacaaggtattatgataggtaaaggaaaagtccagtacgattccaaagaa
ctaaaaaatataataggcaaaaaaaacaaagaggtcataaaaacagacgatatctatatc
atacacatataa

DBGET integrated database retrieval system