KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0506Help
Entry
HY04AAS1_0506     CDS       T00745                                 

Definition
(GenBank) S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Brite
Enzymes [BR:hya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     HY04AAS1_0506
Transfer RNA biogenesis [BR:hya03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    HY04AAS1_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth UPF0223
Motif
Other DBs
NCBI-ProteinID: ACG57193
JGI: HY04AAS10506
UniProt: B4U7T2
Position
444947..445978
Genome map
AA seq 343 aa AA seqDB search
MDISLFDYDLPEELIAKYPVNPRHSAKLMVLDRKSSNITHSTFWHIDEFLEEGDLLIFND
TKVLPARLLGKKKGIENSNVEILLLRHLENEKWEALVGGKNIKPGLVIEISYDFEAIVES
QIEKSKFLVLLKAKNQNQIEAINKYGKIPIPPYLGRDEEPIDKEFYQTVFAKKEFSVAAP
TASLHFSNELLEKLKKKVNIDFVTLHVSYGTFKPVTVQNIEEHKVDEEYIEVSESLIKNI
KKTKKMCKRVIAVGTTVTRALETAIDKPYFGFTDLYIKPGFKFKVLDGFITNFHLPKSSL
LILVSAFCNEENLDGREFILKSYKEAVKHKYRFYSYGDGMLIL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggatatatcactgtttgattacgatttaccagaagagctcattgccaaatacccggta
aatccaagacatagcgctaagctgatggttttagatagaaaaagctccaatataactcac
tcaacgttttggcatatagatgagtttttggaagaaggggatttattgatattcaacgac
accaaggtattaccggcaagacttttaggaaagaaaaaggggatagaaaactcaaatgta
gaaatacttcttttaagacacttagaaaatgaaaaatgggaagctcttgtggggggtaaa
aatataaaaccagggctcgtgatagaaatatcttatgattttgaagcaatagtagagtct
caaatagaaaaatctaagtttttggtgcttttaaaagctaaaaaccaaaatcaaattgag
gcaataaacaaatacggcaaaataccaataccaccatatttaggaagagatgaagagcca
atagataaagaattttatcaaacagtatttgcaaaaaaagaattttctgtggcagcccca
acggcatcgcttcacttttctaatgagcttttggaaaaactaaagaaaaaagtaaatata
gattttgtaacactccacgtatcatacggaacttttaaaccagtaactgtgcaaaacata
gaagagcacaaagtagatgaagagtatatagaagtctcagaatcccttataaaaaatatt
aaaaaaacaaaaaaaatgtgtaaaagggtaatagcggttggcactacagttacaagggca
ttagaaaccgctatcgataaaccatattttggttttacagatctttatataaaacctgga
tttaaatttaaagtcctagatgggtttattacaaactttcatcttccaaaatcatcactt
cttatacttgtaagcgctttttgtaatgaagaaaacttagacggtagagagtttatatta
aaatcctacaaagaggctgtaaaacacaaatatagattttactcatacggagatggcatg
cttatactttag

DBGET integrated database retrieval system