KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0520Help
Entry
HY04AAS1_0520     CDS       T00745                                 

Definition
hypothetical protein
Organism
hya  Hydrogenobaculum sp. Y04AAS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
458699..458920
Genome map
AA seq 73 aa AA seqDB search
MDFLKSLTVNQGLRLLSGSVLLFVFLFGILGSDVGFLWKLLILFMAINQIQSAFTNWCPA
ITMLKNLGLKEDC
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggattttcttaaaagcctaacagttaatcaaggcttaagattgttatcgggtagtgta
cttcttttcgttttcttatttggtatattgggttctgacgtaggatttctttggaaactt
ctcatattgtttatggctataaatcaaatacaatctgcttttacaaattggtgtccagcc
attacaatgcttaaaaatctagggttaaaagaggattgttag

DBGET integrated database retrieval system