KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0607Help
Entry
HY04AAS1_0607     CDS       T00745                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HY04AAS1_0607
   01230 Biosynthesis of amino acids
    HY04AAS1_0607
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_0607
   00030 Pentose phosphate pathway
    HY04AAS1_0607
   00051 Fructose and mannose metabolism
    HY04AAS1_0607
  Energy metabolism
   00680 Methane metabolism
    HY04AAS1_0607
Enzymes [BR:hya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HY04AAS1_0607
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HY04AAS1_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(542375..543520)
Genome map
AA seq 381 aa AA seqDB search
MKITLSVIKADIGGYVGHSCTHPDVVKTTEEYVRKFVGNLIIDLKVLTCGDDIALVMTHQ
HGVDSEKIHKLAWDAFSAGTEVAKKLKLYGAGQDLLTDAFSGNIKGLGPGVAEMEFEERP
SEPVIVYFADKTSPSAWNLALYEMFASPMNTAGLVIDPKMHEGFTFTVLDVYTGKAVKLN
TPSELYDLLALISSASKYVVKEVHRNIDGEIAAVASIQKLSLIAGQYVGKDDPVMIVRTQ
SGFPAVGEALEPFARPWIVEGWMRGSHNGPIMPVGFEDATPSRFDGPPRVIAAGFQIANG
MLVGPRDMFKDKAYDYARKVASDIANILRRQGIFEPHRLPSEEMEYTTLPKVIEKLSSRF
FDVDNNVSSDKSNMLVKEDMD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactttaagcgttatcaaagcagatattggaggatatgtaggtcattcttgc
acccatccagatgtggtaaaaaccacagaagaatatgttagaaagtttgtaggtaatctt
ataatagatttaaaagtacttacctgtggagatgatatagctcttgttatgacgcatcag
catggtgtggatagcgaaaagatacacaaattagcatgggatgctttcagtgctggcaca
gaagtagctaaaaagcttaaactatacggcgctggtcaggatttgttgactgatgctttt
agtggaaatataaaaggtttaggtcctggtgttgctgaaatggagtttgaagaaaggcca
tcagagccggtgatagtatattttgcagacaaaacgtcacctagcgcttggaaccttgct
ctttacgagatgtttgctagtcccatgaatacagctggtcttgttatagatccaaaaatg
cacgaaggctttacctttactgtgttagacgtttatactggaaaagccgttaaactaaac
actccatcagagctttacgatttgttagctcttattagctcagcatcaaagtatgtggtt
aaagaggtgcatagaaatatagacggtgaaatagctgcagttgcatctattcaaaaattg
tctttaatagctggccagtatgtaggaaaagatgatccagtaatgattgtacgtactcaa
agcggttttccagctgtgggtgaagccttagaaccttttgctagaccttggatagtagag
ggctggatgagaggatctcacaatggtccaattatgccagttggctttgaggatgcaaca
ccatcaagatttgacggtccgccaagggtaatagctgctggttttcaaatagccaacggt
atgttggtaggtccaagagacatgtttaaagataaagcttatgattatgctagaaaagta
gcctctgatatagcaaacatattaagaagacaaggtatttttgaaccacacagattgcca
agcgaagagatggaatatactaccttaccaaaagttatagaaaaattgagttcaaggttt
tttgatgtggataacaacgtctcaagcgataagtcaaatatgctagttaaagaagacatg
gattaa

DBGET integrated database retrieval system