KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0611Help
Entry
HY04AAS1_0611     CDS       T00745                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HY04AAS1_0611
   00052 Galactose metabolism
    HY04AAS1_0611
   00500 Starch and sucrose metabolism
    HY04AAS1_0611
   00520 Amino sugar and nucleotide sugar metabolism
    HY04AAS1_0611
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HY04AAS1_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
545913..546791
Genome map
AA seq 292 aa AA seqDB search
MDVRKAVIPSAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEELLMSSIENIIFVTGRHK
RPLEHHFDVNTDLEIFLEKNNKKDLLENIKTVSHLINPIYIRQKEQLGLGHAVLTAEPVV
GAEPFVVSLGDIVIQTDVNIISEMKNLYKKFGKSIVAVYEVPREEVYKYGIVSGKEIEDD
IFLIENMVEKPDVETAPSNLAILGRYLFTPTIFEKLKNTKPGKGGEIQLTDAMKMLLEDE
AVYAYKVKARVYDTGNKLDYLKTIVEFALQREDLKDEFFSFLKDVVKNNGLL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatgttagaaaagccgttataccttctgctgggtggggcacaaggtttttaccagct
actaaggcaatgccaaaagagatgtttccaataatagataagccagttatccaatttatt
gtagaagagctcttgatgagcagcatagaaaatataatatttgtcactggaaggcataaa
agacctttagagcaccattttgatgtaaatacagatttagagatttttctcgagaaaaac
aacaaaaaggacctacttgaaaacataaaaacagtttctcaccttataaatccaatatat
ataagacaaaaagagcagctcggtcttggacatgctgtcttaacagctgagcccgtagta
ggtgcagagcctttcgttgtctctctcggtgatatagtaattcagacagatgtaaacatc
atctcagagatgaaaaatctttacaaaaaatttgggaaaagtatagtagcagtttatgaa
gttccaagagaagaagtgtataaatacggtatagtatctggaaaagaaatagaagatgat
atatttctaatagaaaatatggtagaaaaaccagacgtagaaacagctccttcgaatctg
gctattttgggaaggtatctttttacacctactatttttgaaaagcttaaaaacacaaaa
ccaggcaaaggtggagaaatacagctcacagatgctatgaagatgcttttagaagatgag
gcagtttacgcttacaaagttaaagcaagggtatatgacacagggaacaagcttgattat
ttaaaaactatagttgaatttgctttacaaagagaggatttaaaagacgagttttttagc
tttttaaaagatgtagtaaaaaataatggcttattataa

DBGET integrated database retrieval system