KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0612Help
Entry
HY04AAS1_0612     CDS       T00745                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HY04AAS1_0612
Enzymes [BR:hya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HY04AAS1_0612
Exosome [BR:hya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HY04AAS1_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
546778..548673
Genome map
AA seq 631 aa AA seqDB search
MAYYKYNYDISLLTDEDLYLFNEGTHYHLYEKLGAHVLEGGVYFAVWAPNAKEVYVEGSF
NFWNKKEYPLRPKGSSGIWEIFIEGLKSYELYKYYIVSNFGYEVEKRDPFAFYTEVPPKS
AGIIYDISGYQWKDDLWLSKRRQSNHYKEPISIYEVHLGSWRRTLENEFLSYKDIAHQLV
EYVKDMGFTHVEFLPIMEHPFYGSWGYQTLSYFAPTSRHGEPKDFMYLVELLHQNDIGVI
LDWVPSHFATDDYGLSFFDGTHLYEHMDKRKGYHPDWGSYIFNYGRHEVRAFLISSANFW
FNKYHVDGIRVDAVASMLYLDYSRKEGEWEPNIYGGKENLEAIDCLRKLNEAVYIFNPGI
FTVAEESTAWPMVTKPTYIGGLGFGFKWDMGWMHDTLNYFSKDPVHRKYHQQDITFRMLY
AFNENFILPLSHDEVVHGKGSLIGKMPGDYWQKFANLRLLLSYMYGSPGKKLLFMGSEFG
QFDEWNHDKSLDWHLLEFDSHKGIQNLVKDLNRLYHQEAALYELDHDPEGFEWIDFQDVE
QSIFSFLRKAKNGDFVICIFNATPVPRHDYKIGVPKPGFYKEILNSDSMYYWGSNVGNAG
LIEAHAEPWHKFNFSISLTLPPLGALFLKLA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcttattataaatacaattacgatataagccttttaaccgatgaagatttgtatctt
tttaacgaaggaacgcattatcatctttatgaaaagcttggagctcatgtacttgaaggt
ggagtatattttgcagtttgggctccaaacgcaaaagaagtctatgtagagggtagtttt
aacttttggaataaaaaagaataccctttaagacccaaaggaagctctggcatatgggaa
atcttcatagagggtcttaaaagctatgaactttataagtattacatagtctcaaacttt
ggatacgaggtagaaaaaagagatccattcgcgttttatacagaagtcccaccaaaaagt
gccggtataatttacgatatatctggctatcaatggaaagatgatttatggctttcaaaa
agaagacagtcaaaccactacaaagaacccataagcatatacgaagtgcatcttggttct
tggagaagaacgttagaaaacgaatttctatcttataaggatatagcccatcagcttgta
gagtatgtaaaagatatgggatttacccatgtagagtttttacctattatggagcatcct
ttttacgggtcttggggatatcaaacgctttcttattttgctcccacatccagacatgga
gagccaaaagattttatgtatcttgtagaacttttgcatcaaaacgatataggtgtgata
ctcgattgggtgccatctcattttgccacagacgattatgggctttctttctttgacggg
actcatctttacgagcacatggacaaaagaaaaggttatcatccggattgggggagctat
atatttaactatggaagacatgaagttagggcgtttttaataagcagtgcgaatttttgg
tttaataaatatcatgtagatggtataagagtggatgccgttgcctccatgctttatctt
gattattcaagaaaagaaggtgaatgggaaccaaatatttacggtggtaaagaaaattta
gaagctattgattgtctaaggaaactaaatgaagcagtatatatctttaatccggggata
tttacggtagcagaagaatccaccgcttggcctatggttacaaaacccacctacatcggg
ggtttggggtttggctttaagtgggatatgggctggatgcacgacacgctaaactatttt
tccaaagatcctgtgcatagaaaatatcatcaacaagatataacgtttaggatgctttat
gcttttaacgaaaacttcatattaccgctctctcacgatgaggtggtgcatggaaaaggt
tctttgataggaaaaatgcccggtgattactggcaaaaatttgcaaatttaagactttta
ctatcttatatgtatggaagtcctggtaaaaagcttctttttatgggtagtgagtttggc
caatttgacgagtggaaccacgataaaagcttggactggcatcttttagagtttgattcg
cataaaggtatacaaaatttggtaaaagatttaaacagactttatcaccaagaggctgct
ctttatgaattagaccacgatccagaaggttttgaatggattgattttcaagacgtagag
caatctattttttcgtttttaagaaaagccaaaaacggtgatttcgtaatctgtattttt
aacgccactcctgtcccaagacatgattataaaataggtgttccaaaaccaggtttttat
aaagaaatattaaattcagactctatgtactattggggttctaacgttggaaacgctgga
ctcatagaagcgcatgctgaaccttggcataagtttaacttttccataagtttaacgctt
ccaccgttaggagcgctatttttaaaattagcttaa

DBGET integrated database retrieval system