KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0626Help
Entry
HY04AAS1_0626     CDS       T00745                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HY04AAS1_0626
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HY04AAS1_0626
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HY04AAS1_0626
Enzymes [BR:hya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HY04AAS1_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
559485..560723
Genome map
AA seq 412 aa AA seqDB search
MAKLKGLKCRECKREYPIEPIHVCEFCFGPLEVNYDYDYIKSTINKENISKGPKSLWRYI
DLLPVENPTVGLTAGFTPLKKADKLGKILGLNNLYIKDDSVNHPTLSFKDRVVSVALSKA
KEFGFDTGACASTGNLANSVAAHCAQSDLNCYVFIPANLESQKIIGSLVFNPTVVAVNGN
YDDVNRLCSEIANDLGWAFVNINIRPYYAEGSKTLAFETIEQLGWIAPDAIVTPAASGSL
LTKIYKGIEEFYKVGLIDKYNTRVYGAQALGCSPIAQAFKEGLDFVKPVKPNTIAKSIAI
GNPADGIYALDVVRKTGGTWETADDNEIIEGMKLLAQTEGIFTETAGGTTIAVLKKLAQQ
GHFKPDEIVVAYITGNGYKTMEVLEGKLNETIHINPTLKEFKEVVLKRTKGA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcaaaggactaaaatgtagagaatgcaagcgtgaatatcctatagaacca
atacacgtttgtgagttttgttttggtcctttggaagtaaattatgattatgattatatt
aaaagcacaataaacaaagaaaacatatcaaaaggtccaaaaagtttatggagatacata
gatttgttacctgtagaaaatcctaccgttgggctaacagcaggctttacccctcttaaa
aaagcagataaacttggaaaaatacttggtcttaacaatttatatataaaagatgattcg
gtaaaccatccaacactttcttttaaagatagagttgtatctgtagctttatccaaagca
aaagaatttggttttgataccggggcttgcgcatccaccggtaatttggcaaattctgta
gcagctcattgcgctcaatcagatctaaattgctacgtttttatacctgcaaatcttgaa
tcccaaaaaattatcggtagtcttgttttcaatcctacagtggtggcagtaaatggaaat
tacgacgatgtaaacaggctatgctcagaaattgccaacgatttaggatgggcttttgta
aatataaatataagaccatactatgcagaaggttcaaaaacccttgcttttgaaactata
gagcaacttgggtggatagctccagatgctatagtaactccagcggcaagtggctccctt
ttaacaaagatttataagggtatagaggaattttacaaagtaggtttgatagacaaatat
aacactagggtatacggggctcaagccctaggatgttcaccgatagcccaagcttttaaa
gaagggcttgattttgtaaaaccagtaaaaccaaataccatagcaaaatcaatagccata
ggaaatccggcagatggtatttatgctcttgatgtggtaagaaaaactggtggcacatgg
gaaacagccgatgacaatgaaataatagaaggtatgaagcttttagctcaaacagaaggg
atatttacagaaacagcgggcggtaccactatagctgtattgaagaaattagctcagcaa
gggcacttcaagccagatgaaattgtagtagcatatataactggtaatggctataagact
atggaagtattggaaggaaaattaaacgagacgatacatataaatccaacgcttaaggaa
tttaaagaggtagtcctcaaaaggactaaaggagcttga

DBGET integrated database retrieval system