KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0640Help
Entry
HY04AAS1_0640     CDS       T00745                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hya00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
574617..575303
Genome map
AA seq 228 aa AA seqDB search
MYKLLLTREEEKNLESKKIFSSYNINTISLPMIETIPKEFELKDFDFDCIIFSSRKAVEI
FFKNLHICKNAKINVYIVGEKTKEYFLGFYNTKNLIARDSIKEILPIVNCKTLWIRTDFE
LPEDIKNMVKNKDIFILEAYKTKHKIYELRKVLETLKAVNGVFFASPSAFLGLLKNLQNY
KYILNEKDIFAIGNTTADAIKNEGFQVTYVPQKPSVESIAKYISSIGT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctgcttctcacaagagaagaagagaaaaacttagaatctaaaaaaatattc
tcttcttacaatataaatactatcagcttacctatgatagaaacaatacccaaagagttt
gagttaaaagactttgactttgattgtataatctttagcagcagaaaagctgtagaaata
ttttttaaaaatttacatatttgcaaaaatgcaaaaattaatgtatatattgtaggagaa
aaaactaaagagtatttcttgggattttacaacacaaaaaacttaattgctagagattca
ataaaagaaatactacctatagtaaactgtaaaactctttggataaggacagacttcgag
cttccagaagatataaaaaatatggtaaaaaacaaagatattttcatattagaagcctac
aaaactaagcataagatttacgaattaagaaaagtactagagactcttaaggcagtaaat
ggagtattttttgctagtccttcagcttttttagggcttttaaaaaatttgcaaaattac
aaatatattttaaacgaaaaagacatatttgctataggaaacactacggcagatgctata
aaaaatgaaggatttcaagtgacttacgtcccccagaaaccaagcgtagaatctatagca
aaatatatatcatctattggcacataa

DBGET integrated database retrieval system