KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0642Help
Entry
HY04AAS1_0642     CDS       T00745                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
576262..577089
Genome map
AA seq 275 aa AA seqDB search
MNIEFKKAKLFKPSLLLAVAIFGIGLGACSKLQTTKCPSNNTIVANVEHFTPPGAKVQVV
AEKPLKQIKGLCEVVIKINDGPPNVIYTDPKGNYFIAGQLLNAITKQNLTQETMNQFLKV
SKNEESGLNQYVAFSYYKGKSYFGTNPPPADKYIYLITDPKCPFCHEAEPLIQKWADKNG
VEVRVILFPLPIHPGAFQSAVGLWCNKKGWNSLHAAYNAKAPLSQCPEGDAFIKNSMQEA
MKLGVQGTPTIIGMDGKMHPGAPSSEKQLDQWLGK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatttaaaaaagctaaactttttaagccaagtttgttgcttgcagtagct
atctttggcatcggtttaggtgcttgtagtaaacttcaaactacaaaatgcccatctaac
aacactatagttgcaaacgtagagcattttacaccgcctggagcaaaagtccaagtagta
gcagaaaaacctttaaaacaaataaaaggtctttgtgaagtagttataaaaataaacgat
ggaccaccaaatgtaatatatacggatccaaaaggaaactattttatagctggtcagctt
ctaaacgctattacaaagcaaaatcttacacaagaaactatgaaccagtttttaaaagta
agcaaaaatgaagaatcaggactaaatcagtatgtagcttttagttattacaaagggaaa
tcttatttcggcacaaatccaccaccagcagacaaatacatatatctaatcactgatcct
aagtgcccattctgccatgaggcggaacctctcatacaaaaatgggcagataaaaatggc
gtagaagtaagagttatacttttcccgctaccaatacatccaggggctttccaatccgct
gtagggctttggtgcaacaaaaaaggatggaacagcctacacgctgcttacaacgcaaaa
gcaccgctatctcaatgtccagaaggagatgcttttatcaaaaactctatgcaagaagct
atgaaacttggagtgcaaggcacacccactattataggcatggatggtaaaatgcaccca
ggagccccaagtagtgaaaaacagttagaccaatggttaggtaaataa

DBGET integrated database retrieval system