KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0765Help
Entry
HY04AAS1_0765     CDS       T00745                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HY04AAS1_0765
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HY04AAS1_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
697907..698557
Genome map
AA seq 216 aa AA seqDB search
MGNIVVLSAPSGAGKTTIAYKLLEELKTLKRVITATTRPKRANEKDGIDYIFLSEQEFKS
MIENNEFVEYANVYGYYYGTPIKSIKNLIEKGYDALLVIDVQGAKNIKKLFPSSLLIFLM
PPSLEELYARFKNRGFEDQNALNRIEAAKSEISCAKYFDFIVVNRYVDETVNMIKSIIYC
NKSRREYFLEHKDHIGNDIINILEGGKCNVFETKDL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacattgtagtattgtctgcaccatctggagctggtaaaaccaccatagcctat
aaacttttagaagagcttaaaacgcttaaaagggtaattactgcaaccacaagaccaaaa
agggccaacgaaaaagacggtatagattatatctttttatctgagcaagagtttaaaagt
atgatagaaaacaacgaatttgttgaatatgcgaacgtttacggttattactatggaact
cctataaaaagcattaaaaatcttatagaaaaaggatacgatgctttactcgtaatagat
gtacaaggcgctaaaaatataaaaaaacttttcccttcttctcttttgatatttttaatg
cctccctctttggaagagctttatgcaagatttaaaaatagaggctttgaagatcaaaac
gctttaaatagaattgaagccgcaaaaagcgagatatcttgtgccaagtattttgatttt
attgtagtaaatagatacgtggatgagactgtaaatatgattaaatctattatttattgc
aacaaatcaagaagagaatactttttagagcacaaagaccacataggaaatgatataata
aatattttagaaggaggtaagtgtaatgtcttcgagaccaaagatttatga

DBGET integrated database retrieval system