KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0765Help
Entry
HY04AAS1_0765     CDS       T00745                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hya00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
697907..698557
Genome map
AA seq 216 aa AA seqDB search
MGNIVVLSAPSGAGKTTIAYKLLEELKTLKRVITATTRPKRANEKDGIDYIFLSEQEFKS
MIENNEFVEYANVYGYYYGTPIKSIKNLIEKGYDALLVIDVQGAKNIKKLFPSSLLIFLM
PPSLEELYARFKNRGFEDQNALNRIEAAKSEISCAKYFDFIVVNRYVDETVNMIKSIIYC
NKSRREYFLEHKDHIGNDIINILEGGKCNVFETKDL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacattgtagtattgtctgcaccatctggagctggtaaaaccaccatagcctat
aaacttttagaagagcttaaaacgcttaaaagggtaattactgcaaccacaagaccaaaa
agggccaacgaaaaagacggtatagattatatctttttatctgagcaagagtttaaaagt
atgatagaaaacaacgaatttgttgaatatgcgaacgtttacggttattactatggaact
cctataaaaagcattaaaaatcttatagaaaaaggatacgatgctttactcgtaatagat
gtacaaggcgctaaaaatataaaaaaacttttcccttcttctcttttgatatttttaatg
cctccctctttggaagagctttatgcaagatttaaaaatagaggctttgaagatcaaaac
gctttaaatagaattgaagccgcaaaaagcgagatatcttgtgccaagtattttgatttt
attgtagtaaatagatacgtggatgagactgtaaatatgattaaatctattatttattgc
aacaaatcaagaagagaatactttttagagcacaaagaccacataggaaatgatataata
aatattttagaaggaggtaagtgtaatgtcttcgagaccaaagatttatga

DBGET integrated database retrieval system