KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0925Help
Entry
HY04AAS1_0925     CDS       T00745                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00020  Citrate cycle (TCA cycle)
hya00640  Propanoate metabolism
hya00660  C5-Branched dibasic acid metabolism
hya00720  Carbon fixation pathways in prokaryotes
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01120  Microbial metabolism in diverse environments
hya01130  Biosynthesis of antibiotics
hya01200  Carbon metabolism
Module
hya_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HY04AAS1_0925
   00640 Propanoate metabolism
    HY04AAS1_0925
   00660 C5-Branched dibasic acid metabolism
    HY04AAS1_0925
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_0925
Enzymes [BR:hya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HY04AAS1_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ACG57612
JGI: HY04AAS10925
UniProt: B4U901
Position
complement(872897..874045)
Genome map
AA seq 382 aa AA seqDB search
MKLHEHQSKELLKKYGLPVPEGYAAFNVKEAKEAAQALGGYPLVVKAQIHCGARGKAGGV
KIVKSDEELEAFSEAILGKILKTVQCPNGKVVSRLLIEKATPIEKEFYLSITLDRSNSKI
LIMASKEGGMEIEELSKEKPDAIIKEYVDPVLGIMPYQTRKLSFALGLNPSLFGKIVSKL
YQAYMDLDASLLEINPLVLTKDGDIVLLDAKVEIDDNAAFRHKDIEELEDITQIDPLEVE
AKKYGLNYIKLEGNIGCMVNGAGLAMTTMDIIKLAGGAPANFLDVGGGASVEQIANAFRI
LTSDENVKAVFINIFGGILRCDRLANGLIEAAKIVNIKIPVVVRLEGTNVEEGRKLLKES
GLNFESAVDMWDGAQKAIKLAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacatgagcatcaatctaaggaattgctcaagaaatatggcttaccagtgcca
gaagggtatgctgcttttaacgttaaagaagcaaaagaagcagctcaggctttgggaggt
tatccattggtggtaaaagcccagattcattgtggcgccagaggaaaagctggtggagta
aagatagtaaaatccgatgaagaactggaagcgttttcagaagctatacttggtaaaatc
ttaaaaacggttcaatgtccaaatggaaaagtggtttcaaggcttttaatagaaaaagca
acccctatagaaaaagagttttatcttagcattacattagataggtcgaattcaaagata
cttataatggcttctaaagaaggtggtatggagatagaggagttatctaaagaaaaacca
gatgcaataataaaagagtatgtggacccagttcttggtataatgccttatcagactaga
aaactctcttttgcacttggtttaaatccatctttgtttggtaaaatagtttcaaagcta
tatcaagcttatatggatttggatgcttctttgttagagataaatcctcttgtacttaca
aaagacggagatatagtgcttttggatgcaaaggtagaaatagatgataatgcagctttt
agacacaaagatatagaagagcttgaagatatcactcaaatagacccgcttgaagtggaa
gccaaaaaatacggtttaaattatataaagcttgagggtaatataggatgtatggtaaat
ggagctgggcttgccatgactactatggatattattaaattggctggtggggcacctgca
aacttccttgatgtaggaggtggtgcttctgtggagcaaatagccaacgcttttaggata
ctcacatccgatgaaaatgtaaaagcagtttttataaatatatttggcgggatactaaga
tgtgatagattggccaatggacttatagaagcggcaaagatcgtcaatataaaaatccct
gtagtggtaaggttagagggcacaaacgtagaagaaggaagaaaactcttaaaagaatct
ggcttaaactttgagagtgctgtagatatgtgggacggcgctcagaaagctataaaactt
gcacaataa

DBGET integrated database retrieval system