KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0970Help
Entry
HY04AAS1_0970     CDS       T00745                                 

Definition
nucleoside-diphosphate kinase (EC:2.7.4.6)
Orthology
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HY04AAS1_0970
   00240 Pyrimidine metabolism
    HY04AAS1_0970
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     HY04AAS1_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(909783..910208)
Genome map
AA seq 141 aa AA seqDB search
MERTLVIVKPDAFEKGATGAIIDILSKNGLRLLALKMFKFTKEKAEGFYYVHRERGFFGE
LVEFMCSGPVVAMVLEGENAISKVRELIGPTDSEEARKIAPNSIRALFGTDKGKNAIHAS
DSKESASYEIPYIFSSLEIYS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggacgcttgtgatagtaaaaccagatgcttttgagaaaggggccaccggagcc
atcattgatatactttctaaaaatggtcttaggcttttggcgctcaaaatgtttaaattt
actaaagaaaaagcagaaggcttttactatgtacatagagaaagagggttttttggtgag
cttgtagagtttatgtgctctggtcctgtggtggcaatggttttagagggtgaaaacgcc
atatcaaaggtaagagagctaatagggcccaccgatagcgaagaggcaaggaagatagct
ccaaattccataagagccctttttggtacagataaaggaaagaatgctatacatgcctct
gattccaaagaatcagcctcttacgagatcccttacatattttcatctttagagatatac
tcatga

DBGET integrated database retrieval system