KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0970Help
Entry
HY04AAS1_0970     CDS       T00745                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00230  Purine metabolism
hya00240  Pyrimidine metabolism
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01130  Biosynthesis of antibiotics
Module
hya_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hya_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hya_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HY04AAS1_0970
   00240 Pyrimidine metabolism
    HY04AAS1_0970
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     HY04AAS1_0970
Membrane trafficking [BR:hya04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    HY04AAS1_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACG57657
JGI: HY04AAS10970
UniProt: B4U946
Position
complement(909783..910208)
Genome map
AA seq 141 aa AA seqDB search
MERTLVIVKPDAFEKGATGAIIDILSKNGLRLLALKMFKFTKEKAEGFYYVHRERGFFGE
LVEFMCSGPVVAMVLEGENAISKVRELIGPTDSEEARKIAPNSIRALFGTDKGKNAIHAS
DSKESASYEIPYIFSSLEIYS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggacgcttgtgatagtaaaaccagatgcttttgagaaaggggccaccggagcc
atcattgatatactttctaaaaatggtcttaggcttttggcgctcaaaatgtttaaattt
actaaagaaaaagcagaaggcttttactatgtacatagagaaagagggttttttggtgag
cttgtagagtttatgtgctctggtcctgtggtggcaatggttttagagggtgaaaacgcc
atatcaaaggtaagagagctaatagggcccaccgatagcgaagaggcaaggaagatagct
ccaaattccataagagccctttttggtacagataaaggaaagaatgctatacatgcctct
gattccaaagaatcagcctcttacgagatcccttacatattttcatctttagagatatac
tcatga

DBGET integrated database retrieval system