KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1066Help
Entry
HY04AAS1_1066     CDS       T00745                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Brite
Enzymes [BR:hya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HY04AAS1_1066
Secretion system [BR:hya02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HY04AAS1_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(994679..995464)
Genome map
AA seq 261 aa AA seqDB search
MYKKLLLSIVAFGMMISSAYAKDACPSKTDVKSILKNFNLPPTLKIEDVSPSKRLKGFCE
VVFKVSPLNAQYFFISKDGNYIIQGQVIDIKHKSLVAPDLSKYEKLSKHQLKKLESHVDF
VYNGKSAKNFVYFITDPQCPFCHEAENPLKEWAKKNHIAIKVILYPVQTPTGSLHPGSVK
KSAELLCDNNASYSMLEFMYSAPVPKSPCKKGLEKVKENISYLQGLGVDGTPTFVGPTGK
VETGIANSKEAMYKEFDNLIK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaaattgttgctatctattgttgcttttggtatgatgataagtagtgcttat
gcaaaggacgcttgtccatcaaaaacagatgttaaaagcatattgaaaaattttaatcta
ccgcctactctaaaaatagaggatgtatctccatccaaaaggcttaaaggtttttgtgaa
gtggtgtttaaggtatctcctctaaacgctcaatacttttttataagcaaagatggaaac
tatataatacaaggtcaagtgatagatataaagcataagtctttggtggccccagatcta
tctaagtatgaaaagctgtcaaaacatcaactaaaaaagttagaaagtcatgttgatttt
gtatacaacggtaaaagcgctaaaaactttgtatatttcataacagatcctcaatgtccg
ttttgtcacgaagcggaaaaccctcttaaagaatgggctaagaaaaaccatatagcaata
aaagtaattttatatcctgtacaaacaccaacaggttctttgcatcctggttctgttaag
aaatccgctgagcttttatgtgacaacaacgctagttatagcatgctggagtttatgtat
agcgctccggtaccaaaaagcccttgtaaaaaaggtttagaaaaagtaaaggaaaatata
tcatatttgcaaggtttaggagtagatggaacgcctacatttgtgggtcctactggaaaa
gtggaaactggtattgcaaactcaaaagaagcaatgtacaaagagtttgacaatctgata
aaataa

DBGET integrated database retrieval system