KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1144Help
Entry
HY04AAS1_1144     CDS       T00745                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HY04AAS1_1144
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HY04AAS1_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1057801..1059126
Genome map
AA seq 441 aa AA seqDB search
MKDAVVIGAGVSGIVAAYTLKKAGFDPLVIEKEPHIGGSTHTLREDGRIIELGVQSVLGQ
EEFMAFAKELNLKPLHPLKEHANTRYVYLNGQLKKMPSNPIEFLTSDFFSIFGKIRLLRE
PFIPPKDDPKESISDFVTRRLGKEFLDKIVEPFVCGIYAGDPDKLSAKYAVRRVKALEDE
YGSIIKGSMKKKALGPQGEITSFEGGLLTFLEKMASGIDISLENVALKITKKDDIYTIDT
KSGKIQTKSILIATPAYSASYLLRNLTWSMSAELDQIEYAPVIVISAIVKHPLPKGFGFL
IPRKENTIMLGALFSSNLFKICKEDENIITIYVGGERRKDVADWPEEKIISQVKKELKQI
LGIEDFEKYYFKKWKKAIPQYNIGYEKFINTVKDIENMNKGVFIAGNYIEGNSFNDSLRY
AMKKANEQILFLKKGVAHAQV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgccgttgtaataggtgcaggcgttagtggaatagtagcagcttatacgctt
aaaaaagctggttttgatcctcttgttatagaaaaagagcctcacataggtggttctacc
catactttgagagaagatggacgtatcatagagcttggcgtgcaatctgtgcttggtcaa
gaagaatttatggcttttgccaaagaactaaatttaaagcctctacatccactaaaagag
cacgccaacacaaggtacgtatatttaaacggtcagcttaagaaaatgccatcaaacccg
attgagtttttaacctctgattttttttctatatttggtaaaatcaggcttttaagagaa
ccatttataccaccaaaagacgatcccaaagaaagtataagcgattttgtaacaaggcgt
cttggcaaagagtttttggataagatagtagaaccctttgtatgcggtatatacgctgga
gacccagacaaattgtctgccaaatacgccgttagaagggtaaaagccttagaagatgaa
tatgggtctatcataaaaggttctatgaagaaaaaagcccttggccctcaaggtgagatc
acatcttttgaaggtgggcttttaacatttttagaaaaaatggcctctggcatagatata
tctttggaaaatgtggcacttaaaatcactaaaaaagacgatatatatactatagatact
aaaagcggtaaaattcaaacaaaatctatactcatagccacaccagcctacagtgcatct
tatcttcttagaaatctcacttggagcatgtctgcggagttagaccagatagagtatgca
cctgttatagtgataagcgctatcgtaaaacatcctcttccaaagggttttgggttttta
ataccaagaaaagaaaataccatcatgcttggagcacttttttcaagcaatctatttaaa
atctgcaaagaagatgaaaacattatcactatatatgtaggcggtgaaagaagaaaagat
gtagcagattggccagaggaaaagatcatttcacaagtaaagaaggagttaaagcaaata
cttggtatagaggattttgaaaaatattatttcaaaaaatggaaaaaagccatacctcaa
tacaacataggctacgagaaatttataaacaccgtaaaggatatagagaatatgaacaaa
ggtgtttttatagcaggaaactatattgaaggtaattcttttaacgactctttaagatac
gccatgaaaaaagcaaacgaacaaattttatttcttaaaaaaggagtggctcatgcacaa
gtttaa

DBGET integrated database retrieval system