KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1198Help
Entry
HY04AAS1_1198     CDS       T00745                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01130  Biosynthesis of antibiotics
hya01230  Biosynthesis of amino acids
Module
hya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HY04AAS1_1198
Enzymes [BR:hya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HY04AAS1_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS SOR_SNZ
Motif
Other DBs
NCBI-ProteinID: ACG57883
JGI: HY04AAS11198
UniProt: B4U9S2
Position
complement(1107456..1108223)
Genome map
AA seq 255 aa AA seqDB search
MGFLEEIVEYKKKSLNKSYSYFDELLGRIKEAKPVLSLKESILSSKAIKTPIIAEIKQAS
PSMGRIKNVDIKDQAYIYQEAGACAISVLTEEKFFNGKLSFLEDVKSVVNIPVMRKDFII
DPLQVYEARAYKADAILLIARILDKYQIEDISYEAKKLGLEILMEIFEEHEIEKVKEFEI
IGLNNRDLDTLDIDINKSKEMLPILKDYTKAVLIAESGISSKEDIEFLKGYDGFLVGTSI
MKEDDPAKKLKELVW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttagaagagatagtagagtataaaaagaaaagcttaaacaagtcctatagt
tattttgatgagcttttgggcaggataaaagaggcaaagcctgtcttgtctttaaaagag
agtatactatcatcaaaagctataaaaacccctatcatagccgagataaaacaagcatcc
ccttctatgggtcgtataaaaaatgttgatataaaagatcaagcttacatatatcaagaa
gctggggcttgcgctatatcggtccttacagaagagaaatttttcaatggaaaacttagt
tttcttgaagatgtaaaaagtgttgtaaatatacctgttatgagaaaggattttataata
gatcctcttcaagtatatgaggcaagggcttataaagccgatgccatacttcttatagca
aggattttagacaaatatcagattgaagatatatcttatgaggcaaaaaagcttggttta
gaaatattgatggaaatttttgaagagcatgagatagaaaaggtaaaagagtttgagata
attggcttaaacaacagagatttggatactcttgatatagatatcaacaaaagcaaagag
atgcttcctattttaaaagattatacaaaagctgttttgatagcagaaagcgggatatct
tcaaaagaagatattgagtttttaaaaggatatgacggatttttggtgggtacatccatt
atgaaagaagatgatccagccaaaaaactgaaggagcttgtatggtaa

DBGET integrated database retrieval system