KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1249Help
Entry
HY04AAS1_1249     CDS       T00745                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HY04AAS1_1249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HY04AAS1_1249
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HY04AAS1_1249
Enzymes [BR:hya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HY04AAS1_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1157942..1158730)
Genome map
AA seq 262 aa AA seqDB search
MNISEVFGLLKQKNKIALLSYMVAGYPDLETSYKAFDILLENGSDMIEIGFPFSDPVADG
PTIQEAHTIALRNGITHKDIFDLSKSLKQKHQDKPFLLMTYFNPIYKMGLDKFFKEAKES
GIDGFIIPDLPAEEAQGVKDALEQRSLSLVMLLAPTSFKNNRIQSVCKMSTDFVYMVSVT
GITGARDILPIESIKEYTTNYRKHCHKPIVLGFGISSKEHIDSLKPYVDGVVVGSHFVKS
LKKEGLEGLKEEAKKLSEATYL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcagaggtttttgggcttttaaaacaaaaaaataaaatagcattgctttct
tacatggtggctggatacccagatttggaaacttcttacaaagcctttgatatactctta
gaaaacggctctgatatgatagagataggttttcctttttcagatcctgtagcagatgga
cccactattcaagaggctcacactatagcccttcggaacggtataacccataaagatata
tttgatctttctaaaagcttaaaacaaaaacatcaagataaaccttttttacttatgaca
tactttaaccctatatataagatgggtcttgataaattttttaaagaggcaaaagagtct
ggtatagatggttttataatacctgatttaccagcagaagaagctcaaggtgtaaaagat
gccttagagcaaagatctcttagtcttgtgatgcttttggctcccacttcttttaaaaac
aacaggatccaaagcgtttgtaagatgtccacagattttgtttacatggtatctgttaca
ggtattacaggggcgagggatatactgcccatagaaagcataaaagaatataccaccaac
tatagaaaacattgtcataagcccatagttcttggttttggtatatcaagcaaggagcat
atcgatagtttaaagccttatgtggatggtgtggtggtgggtagtcattttgttaaaagc
ctaaaaaaagaaggcttggaagggttaaaagaagaagctaaaaaactttctgaagccact
tatctatga

DBGET integrated database retrieval system