KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1356Help
Entry
HY04AAS1_1356     CDS       T00745                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HY04AAS1_1356 (tpiA)
   01230 Biosynthesis of amino acids
    HY04AAS1_1356 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_1356 (tpiA)
   00051 Fructose and mannose metabolism
    HY04AAS1_1356 (tpiA)
   00562 Inositol phosphate metabolism
    HY04AAS1_1356 (tpiA)
Enzymes [BR:hya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HY04AAS1_1356 (tpiA)
Exosome [BR:hya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HY04AAS1_1356 (tpiA)
  Exosomal proteins of bladder cancer cells
   HY04AAS1_1356 (tpiA)
  Exosomal proteins of melanoma cells
   HY04AAS1_1356 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1267265..1268005)
Genome map
AA seq 246 aa AA seqDB search
MKKIIAANWKMHKTYEEAISYINELLKKNIDFEKKDVLIYPPFLYVCEVSKLLEKSNIKV
GAQNVYYEKKGAFTGEISPVMVKSCKAHYVLIGHSERRHIFKESDELIRKKVISSLEEGL
KVMLCVGETLEERESQLTFNVIESQLKLALAGLEEWFENIEIAYEPVWAIGTGKSANTED
ASKIHSFIKDTLKDIAKKDTDIRVLYGGSVNPQNAKEFLKAPNVDGLLVGGASLDPNTFL
EIINAC
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattatagccgccaattggaagatgcataaaacctatgaggaagccatatct
tatataaatgagctgttgaagaaaaatatagattttgaaaaaaaagatgttcttatatat
ccgccgtttttatatgtatgcgaggtttctaagcttttagaaaaatcaaatataaaagta
ggagctcaaaacgtatactacgaaaagaaaggagcttttaccggagagatatcaccggtg
atggtaaaatcctgtaaggcccattatgtgctcataggacattcagaaagaaggcacata
tttaaagaatccgatgagttaataaggaaaaaagtgatatcttcattggaagaaggtcta
aaggtgatgctttgtgtaggggaaactttagaagaaagggagtctcagcttacttttaac
gttatagaatctcaattaaagcttgcactggctggtttagaagagtggtttgagaatata
gaaatagcttacgagcctgtttgggcaataggcactggcaaatctgcaaatacagaggat
gcttcaaagatacatagctttataaaagatacattaaaagatatagcaaaaaaagatacg
gacataagagttttgtatggggggagtgtaaatccacaaaacgctaaagaatttctaaaa
gcaccaaacgtagatgggcttttggtaggtggtgcaagcttagatccaaacacgttttta
gagataataaacgcttgctaa

DBGET integrated database retrieval system