KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1414Help
Entry
HY04AAS1_1414     CDS       T00745                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00900  Terpenoid backbone biosynthesis
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HY04AAS1_1414
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HY04AAS1_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF2007
Motif
Other DBs
NCBI-ProteinID: ACG58099
JGI: HY04AAS11414
UniProt: B4U5Q9
Position
1330982..1331836
Genome map
AA seq 284 aa AA seqDB search
MNKKNNLLVLEDGVKVILAPAKVNFGLWIKGKRPDGYHDIFSIIHTIDLYDRIYIELHYT
LEVLSVGPFSKNLKDNIVYEGVLAFSRLTGKNFDYKIVIEKNIPVGAGLGGASSDLAAVI
SYLNEELENPMKEQELTDFLSSFSKDAPFFLKGGCALVYGTGDQVKVLEPISREITVVYP
NIEASTSKVYGAFTKQTEEVLLLEDILRLLEENDIENIIENHLQETAIEIYKEIGELIRF
LESVGYKPYMSGSGSSVYVFGKLSDKIKMALESRGWYVYECKTI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaaataatctgcttgttttagaagatggtgtaaaggttattttagcgcca
gcaaaggtaaattttggactttggataaaaggcaagaggccagatggctatcacgatata
tttagcataatccacacgatagatttgtacgatagaatatacatagagctccattacact
ctagaagtgcttagtgttggccctttttctaaaaatctaaaagacaacatagtctatgaa
ggagttttagcattttcaagactaactggtaaaaattttgattataaaatagtaattgaa
aaaaatatacctgtgggtgctggtttaggtggtgctagttccgatttggcagctgtgata
agctatttaaacgaagagcttgaaaaccctatgaaagaacaggagcttacagattttcta
tcttcttttagcaaggatgcgccatttttcttaaaaggtggatgcgctttggtctacggc
accggtgaccaagtaaaagttttagagcctatttccagagaaataacagtagtatatccg
aatatagaagcttctacttctaaagtttacggtgcttttacaaaacaaactgaagaagtt
ttgttgttggaagatattttaaggcttttagaagaaaacgatatagaaaatattatcgaa
aatcacttacaagaaaccgctattgaaatatacaaagaaataggagaactcataagattt
ttggaaagcgtcggatacaagccgtatatgtctgggagcggttcaagcgtttatgtgttt
ggtaagctaagcgataagattaaaatggctttagagtcgaggggttggtacgtatacgaa
tgcaaaaccatataa

DBGET integrated database retrieval system