KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1421Help
Entry
HY04AAS1_1421     CDS       T00745                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HY04AAS1_1421
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_1421
   00052 Galactose metabolism
    HY04AAS1_1421
   00500 Starch and sucrose metabolism
    HY04AAS1_1421
   00520 Amino sugar and nucleotide sugar metabolism
    HY04AAS1_1421
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HY04AAS1_1421
   00524 Butirosin and neomycin biosynthesis
    HY04AAS1_1421
Enzymes [BR:hya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HY04AAS1_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1336611..1337474)
Genome map
AA seq 287 aa AA seqDB search
MILSLDVGATHIKSGIVEDGSIKNRLDFETPKDFEEFLRLLEKIISHYKDIDTLSIAIAG
QVDMKKGILKHAPNLGWKDINFVELVQNRLKKRTILINDVRAITYGEYIYGGLKDVENGA
CVFVGTGIGGGLIIDKELRFGCDSNLGEIGHMKLKPNGLKCTCGKRGCFEAYAGGLSLER
YLKKLGYNKSLKDLVSEKDSKVAKKVFDRFVLYMSYGLASLINMLNPCKIVLGGGVMMGF
SFLFEEIKNKAISLSIDPSVEHIDITLSELGNDAGILGAHAFAMKHI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatactctctttagatgtaggggctactcatataaaatctgggatagtagaagatggt
agtataaaaaataggcttgattttgaaacaccaaaagattttgaagagtttttgaggctt
ttagaaaaaataatatctcattataaggatatagatacactttctatagcaatagctggt
caagtggatatgaaaaaaggtattttaaaacacgcaccaaacttaggctggaaagatata
aattttgtagagcttgtgcaaaatagattaaaaaaaaggactatcctaataaacgacgtt
agggctatcacgtacggagaatacatatacggcgggttaaaagatgtagaaaacggagct
tgtgtttttgtaggtacaggtataggtggtgggcttatcatagataaagagcttaggttt
ggctgtgattcaaacttaggtgagatagggcatatgaaactaaaaccaaatgggctaaaa
tgcacctgcggtaaaaggggctgttttgaagcttacgctggggggctttctttggagaga
tatttaaaaaaattaggttataataaaagcttaaaagatttggttagtgaaaaagactca
aaagttgcaaaaaaggtttttgataggtttgttttgtatatgtcttatgggcttgctagt
ttgataaatatgttaaatccatgtaagatagtgcttgggggtggtgttatgatgggtttt
agctttttgtttgaagagataaaaaataaagctatttcactatctatagacccaagcgtt
gagcatatagatatcacactttcagagcttggaaacgatgctgggatactgggagctcac
gcttttgctatgaagcatatatga

DBGET integrated database retrieval system